LXL04_020985 | RubberDandelionOmics

Gene overview

LXL04_020985

Reference: OH-1004 Chr: Chr04 Coordinates: 117306384-117306950 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · LXL04_020985|LXL04_020985|OH1004|cDNA

ATGGAAAGCAACTCAGAATCTCCGCTTCTTACCTCCATCGATGGCACACAAAACGCTCACTTCGTCGGAGACATTGAACATATCCCTCCGATCAAAGGATTGGACGATTTCTTTCTCCAATTTCATGTCGAATCAAATGAACACTCGATCTCGCAGCTTTCTCCGTCGAGAACTCAGTCATTGCCGTTTTCTCCTTCGGAATCATGGTTAGTATTTATTAACGATTTGAAATCGAACATCCTCTACATCTTCGCAACACC...

CDS

Download CDS FASTA

519 bp · LXL04_020985|LXL04_020985|OH1004|CDS

ATGGAAAGCAACTCAGAATCTCCGCTTCTTACCTCCATCGATGGCACACAAAACGCTCACTTCGTCGGAGACATTGAACATATCCCTCCGATCAAAGGATTGGACGATTTCTTTCTCCAATTTCATGTCGAATCAAATGAACACTCGATCTCGCAGCTTTCTCCGTCGAGAACTCAGTCATTGCCGTTTTCTCCTTCGGAATCATGGTTAGTATTTATTAACGATTTGAAATCGAACATCCTCTACATCTTCGCAACACC...

Protein

Download Protein FASTA

172 aa · LXL04_020985|LXL04_020985|OH1004|PROTEIN

MESNSESPLLTSIDGTQNAHFVGDIEHIPPIKGLDDFFLQFHVESNEHSISQLSPSRTQSLPFSPSESWLVFINDLKSNILYIFATPLLLLIGQTEDISHAAGKMAIWMIPQLFAYAFNFPIAKFLQSQSKIMVMAYISAAVLIPDYFSSLHILRPSKFRTINSSHPLYSCC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020985`
TK1151 ID	TkA05G336960
OH-1004 ID	LXL04_020985
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020985

Location Chr04:117306384-117306950 (-)

Description Similar to DTX31: Protein DETOXIFICATION 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12950`	Positively mediates root hair elongation.	No verified direct reference in this release
`At3g26590`	Protein DETOXIFICATION 29.	No verified direct reference in this release
`At1g23300`	Protein DETOXIFICATION 32.	No verified direct reference in this release
`At5g38030`	Protein DETOXIFICATION 30.	No verified direct reference in this release
`At1g47530`	Protein DETOXIFICATION 33.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020985 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0048767 root hair elongation Biological Process

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G12950

ath:AT1G23300

ath:AT1G47530

ath:AT3G26590

ath:AT5G38030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.376

Rank 1 · LXL04_020985 · OH-1004

Nucleus0.184

Rank 2 · LXL04_020985 · OH-1004

Lysosome / Vacuole0.179

Rank 3 · LXL04_020985 · OH-1004

Cell membrane0.157

Rank 4 · LXL04_020985 · OH-1004

Cytoplasm0.157

Rank 5 · LXL04_020985 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554.24MatE80-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020985	`PF01554.24`	MatE	80	142	1e-10	42.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPV4`	Arabidopsis thaliana	Protein DETOXIFICATION 31	51.429%	Swiss-Prot	moderate database homology
`Q38956`	Arabidopsis thaliana	Protein DETOXIFICATION 29	62.025%	Swiss-Prot	weak database homology
`F4I4Q3`	Arabidopsis thaliana	Protein DETOXIFICATION 32	64.615%	Swiss-Prot	weak database homology
`Q9LS19`	Arabidopsis thaliana	Protein DETOXIFICATION 30	55.056%	Swiss-Prot	moderate database homology
`Q9SX83`	Arabidopsis thaliana	Protein DETOXIFICATION 33	62.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card