LXL04_020941 | RubberDandelionOmics

Gene overview

LXL04_020941

Reference: OH-1004 Chr: Chr04 Coordinates: 115906224-115908857 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

993 bp · LXL04_020941|LXL04_020941|OH1004|cDNA

AGGAAACAAGAAACCAATCTCCACGCTGTCTTCTTCTCTCACGCGTTCATGGCCGCAACAGCattctctctttcttcctcCATTGACCTCTACCACCAACACAACCTCCAACTCCACCGCAATCtccgccaccagccaccgtaTTCCAAAACCCACATCTTCCCCCACCCTTCCTCCAAGATCTTCCCCAAATCCACAAATCTCTTTCTCACTTGCTCCTCTCACTCCTCATCATCTCCAACTCTCCAAGAAAACCCTCT...

CDS

Download CDS FASTA

945 bp · LXL04_020941|LXL04_020941|OH1004|CDS

ATGGCCGCAACAGCATTCTCTCTTTCTTCCTCCATTGACCTCTACCACCAACACAACCTCCAACTCCACCGCAATCTCCGCCACCAGCCACCGTATTCCAAAACCCACATCTTCCCCCACCCTTCCTCCAAGATCTTCCCCAAATCCACAAATCTCTTTCTCACTTGCTCCTCTCACTCCTCATCATCTCCAACTCTCCAAGAAAACCCTCTTCCCACCGGAAAGTTCCTCTCAAACCCTGATCTTCAAAAGCTCAAATT...

Protein

Download Protein FASTA

314 aa · LXL04_020941|LXL04_020941|OH1004|PROTEIN

MAATAFSLSSSIDLYHQHNLQLHRNLRHQPPYSKTHIFPHPSSKIFPKSTNLFLTCSSHSSSSPTLQENPLPTGKFLSNPDLQKLKFLENFKIFHKLPSGSMLLIRVMQEQEMDMTVDLLAESFAESMMLPKTYVKLLGFLVKQYLVERRTSMPHAATLIAFHRRDTDEEGGEMEDIQLAGTVEVSFNKLGANVSPPSPTPPKDAPYICNMTVKKSLRRQGIGWHLLKASEELISEMSSVREVYLHCRMIDSAPFNMYSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020941`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020941

Location Chr04:115906224-115908857 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24040`	Protein acetyltransferase with dual specificity triggering both N-alpha-acetylation (NTA), with a large spectrum of modified N-termini, including methionine, alanine, serine and to a lower extent threonine and valine as substrates, and epsilon-lysine acetylation (KA).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020941 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006474 N-terminal protein amino acid acetylation Biological Process

GO:0018394 peptidyl-lysine acetylation Biological Process

GO:0009507 chloroplast Cellular Component

GO:0004596 protein-N-terminal amino-acid acetyltransferase activity Molecular Function

GO:0008080 N-acetyltransferase activity Molecular Function

GO:0061733 protein-lysine-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G24040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.970

Rank 1 · LXL04_020941 · OH-1004

Nucleus0.034

Rank 2 · LXL04_020941 · OH-1004

Mitochondrion0.029

Rank 3 · LXL04_020941 · OH-1004

Cytoplasm0.025

Rank 4 · LXL04_020941 · OH-1004

Cell membrane0.017

Rank 5 · LXL04_020941 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00583.32Acetyltransf_1179-263 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020941	`PF00583.32`	Acetyltransf_1	179	263	5.7e-06	27.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LR91`	Arabidopsis thaliana	GCN5-related N-acetyltransferase 5, chloroplastic	61.441%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card