Gene Card
Gene overview
cDNA / CDS / Protein Sequences
594 bp · LXL04_020726|LXL04_020726|OH1004|cDNA
ATGTGGGATCAATCCTCTAAAAGAACTATCAGTGATATATCCAAAACTCCAGCCTCGCAGAAGCCCTTAATCGACATCAATGTTCGCCGGTTCCTTCCTCCAACTCCAGCCTCGCAGAACCAGAGCTTACAACGCCGGAGAAAACGGAGACCACGACTTCTGCTTCCGACTTCTGCTTCTGAAGGCGGAATAGCCAGACGAGGAATAGTCAGACGAGGTAAGAATGCTTATCAGTGGGGTCCGATTGCTTCCAATTTCGG...
594 bp · LXL04_020726|LXL04_020726|OH1004|CDS
ATGTGGGATCAATCCTCTAAAAGAACTATCAGTGATATATCCAAAACTCCAGCCTCGCAGAAGCCCTTAATCGACATCAATGTTCGCCGGTTCCTTCCTCCAACTCCAGCCTCGCAGAACCAGAGCTTACAACGCCGGAGAAAACGGAGACCACGACTTCTGCTTCCGACTTCTGCTTCTGAAGGCGGAATAGCCAGACGAGGAATAGTCAGACGAGGTAAGAATGCTTATCAGTGGGGTCCGATTGCTTCCAATTTCGG...
Protein
Download Protein FASTA197 aa · LXL04_020726|LXL04_020726|OH1004|PROTEIN
MWDQSSKRTISDISKTPASQKPLIDINVRRFLPPTPASQNQSLQRRRKRRPRLLLPTSASEGGIARRGIVRRGKNAYQWGPIASNFGIARRGFAEATQLHQWKITQVEEYQFASRYRLLPIASKYRLLPIAFNLEISLQGGRFQSCLREIHACAQDVEDKKKGIKINKEDWQKLNPHIASYNNFPIFHCCDTMRTCI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_020726 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_020726 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:107021303-107022445 (+) | |||||||||
| Description | Similar to MVD2: Diphosphomevalonate decarboxylase 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0016104 triterpenoid biosynthetic process Biological Process GO:0016126 sterol biosynthetic process Biological Process GO:0016135 saponin biosynthetic process Biological Process GO:0019287 isopentenyl diphosphate biosynthetic process, mevalonate pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005777 peroxisome Cellular Component GO:0005829 cytosol Cellular Component GO:0004163 diphosphomevalonate decarboxylase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0042802 identical protein binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G38700 ath:AT3G54250 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.