LXL04_020627 | RubberDandelionOmics

Gene overview

LXL04_020627

Reference: OH-1004 Chr: Chr04 Coordinates: 98944371-98948540 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

726 bp · LXL04_020627|LXL04_020627|OH1004|cDNA

atgaaaatacaggattttcacaaaacaaacacttatgaactcaccaacctttgtgttgacactttcagaactcatgcaatctcagGGAAGAGAATAAAGCAAACGGGATTTGGGGGCGTTGGTGGGATGGGATTTCAGCGGCTCCCTCCAGATTTTGATACCGTTGATGAGCGGCTTCAGCGGGAGGGGGAATCAGTGGGTTCCGACTGGACAACACCATCCCCTTCATCTCGGTCACATCCACCATCCCCTCCATCGGA...

CDS

Download CDS FASTA

726 bp · LXL04_020627|LXL04_020627|OH1004|CDS

ATGAAAATACAGGATTTTCACAAAACAAACACTTATGAACTCACCAACCTTTGTGTTGACACTTTCAGAACTCATGCAATCTCAGGGAAGAGAATAAAGCAAACGGGATTTGGGGGCGTTGGTGGGATGGGATTTCAGCGGCTCCCTCCAGATTTTGATACCGTTGATGAGCGGCTTCAGCGGGAGGGGGAATCAGTGGGTTCCGACTGGACAACACCATCCCCTTCATCTCGGTCACATCCACCATCCCCTCCATCGGA...

Protein

Download Protein FASTA

241 aa · LXL04_020627|LXL04_020627|OH1004|PROTEIN

MKIQDFHKTNTYELTNLCVDTFRTHAISGKRIKQTGFGGVGGMGFQRLPPDFDTVDERLQREGESVGSDWTTPSPSSRSHPPSPPSDKNQNGGAKELLQSISEKQGRKMNSTESAKDIQPFLKFFKDQVNMAEVKYPLDHFKTFNEFFIRELKPGARPIAYVGRDDVAVCAADCRLMAFKTVEESLRFWIKGKKFSIRGLLGNLPISDTFNGGTLVIFRLAPQAAELEIEAYQMMIRSYQY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020627`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020627

Location Chr04:98944371-98948540 (-)

Description Similar to PSD3: Phosphatidylserine decarboxylase proenzyme 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25970`	Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer).	Deficiency in phosphatidylserine decarboxylase activity in the psd1 psd2 psd3 triple mutant of Arabidopsis affects phosphatidylethanolamine accumulation in mitochondria.2007 · DOI: 10.1104/pp.107.095414
`At5g57190`	Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer).	Deficiency in phosphatidylserine decarboxylase activity in the psd1 psd2 psd3 triple mutant of Arabidopsis affects phosphatidylethanolamine accumulation in mitochondria.2007 · DOI: 10.1104/pp.107.095414

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0959800`	Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020627 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006646 phosphatidylethanolamine biosynthetic process Biological Process

GO:0006656 phosphatidylcholine biosynthetic process Biological Process

GO:0016540 protein autoprocessing Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005795 Golgi stack Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT4G25970

ath:AT5G57190

dosa:Os01g0959800

ppa:PAS_chr3_1127

spo:2543178

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.350

Rank 1 · LXL04_020627 · OH-1004

Nucleus0.307

Rank 2 · LXL04_020627 · OH-1004

Mitochondrion0.246

Rank 3 · LXL04_020627 · OH-1004

Cell membrane0.080

Rank 4 · LXL04_020627 · OH-1004

Plastid0.072

Rank 5 · LXL04_020627 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02666.21PS_Dcarbxylase144-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020627	`PF02666.21`	PS_Dcarbxylase	144	223	4.5e-15	56.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A4GNA8`	Arabidopsis thaliana	Phosphatidylserine decarboxylase proenzyme 3	76.336%	Swiss-Prot	moderate database homology
`F4KAK5`	Arabidopsis thaliana	Phosphatidylserine decarboxylase proenzyme 2	76.336%	Swiss-Prot	moderate database homology
`Q5JN42`	Oryza sativa subsp. japonica	Phosphatidylserine decarboxylase proenzyme 2	65.649%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card