LXL04_020491 | RubberDandelionOmics

Gene overview

LXL04_020491

Reference: OH-1004 Chr: Chr04 Coordinates: 83319305-83321997 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · LXL04_020491|LXL04_020491|OH1004|cDNA

ATGCTTGCACGCCTTCACTGGGATTCTTGGTTTCCTCCTGCACGCCTGATTCTTATCTGCTTTCTACCACTATACAAAGCTTTAAAGAGAAAGGAGAAGGATTTCCATTCGATTTCGACTCAGTGCGAAGAGATCGTCGATCATCAAGCGGTCAAATATGATGGTGGAGCTGTTCGGAGATCGAAGCTGTTTCCGTTCACGCTTTTCTTCTTCAATTTGCTATTCATAATGTTGAATGAAAACGAATTTGAATCAGTCAA...

CDS

Download CDS FASTA

525 bp · LXL04_020491|LXL04_020491|OH1004|CDS

ATGCTTGCACGCCTTCACTGGGATTCTTGGTTTCCTCCTGCACGCCTGATTCTTATCTGCTTTCTACCACTATACAAAGCTTTAAAGAGAAAGGAGAAGGATTTCCATTCGATTTCGACTCAGTGCGAAGAGATCGTCGATCATCAAGCGGTCAAATATGATGGTGGAGCTGTTCGGAGATCGAAGCTGTTTCCGTTCACGCTTTTCTTCTTCAATTTGCTATTCATAATGTTGAATGAAAACGAATTTGAATCAGTCAA...

Protein

Download Protein FASTA

174 aa · LXL04_020491|LXL04_020491|OH1004|PROTEIN

MLARLHWDSWFPPARLILICFLPLYKALKRKEKDFHSISTQCEEIVDHQAVKYDGGAVRRSKLFPFTLFFFNLLFIMLNENEFESVKGSGGCVDAVSAAIETLEHHCRNCGDIFCDKCTQGRIALTVEENAQQVRVCDQCMAEVTQRLSHVNEVAANKASGFNRHEDVTSLVEE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020491`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020491

Location Chr04:83319305-83321997 (-)

Description Similar to FREE1: Protein FREE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20110`	Endosomal sorting complex required for transport (ESCRT) component regulating multivesicular body (MVB) protein sorting and plant growth.	A unique plant ESCRT component, FREE1, regulates multivesicular body protein sorting and plant growth.2014 · DOI: 10.1016/j.cub.2014.09.014 Dual roles of an Arabidopsis ESCRT component FREE1 in regulating vacuolar protein transport and autophagic degradation.2015 · DOI: 10.1073/pnas.1421271112 FYVE1 is essential for vacuole biogenesis and intracellular trafficking in Arabidopsis.2015 · DOI: 10.1104/pp.114.253377 FYVE1/FREE1 Interacts with the PYL4 ABA Receptor and Mediates Its Delivery to the Vacuolar Degradation Pathway.2016 · DOI: 10.1105/tpc.16.00178 The effect of ABRE BINDING FACTOR 4-mediated FYVE1 on salt stress tolerance in Arabidopsis.2020 · DOI: 10.1016/j.plantsci.2020.110489

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020491 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007034 vacuolar transport Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0015031 protein transport Biological Process

GO:0030100 regulation of endocytosis Biological Process

GO:0031623 receptor internalization Biological Process

GO:0032456 endocytic recycling Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0036258 multivesicular body assembly Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0070676 intralumenal vesicle formation Biological Process

KEGG gene cross-reference

ath:AT1G20110

ddi:DDB_G0292924

hsa:55680

pon:100173704

uma:UMAG_03862

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.448

Rank 1 · LXL04_020491 · OH-1004

Nucleus0.364

Rank 2 · LXL04_020491 · OH-1004

Mitochondrion0.127

Rank 3 · LXL04_020491 · OH-1004

Cell membrane0.111

Rank 4 · LXL04_020491 · OH-1004

Golgi apparatus0.086

Rank 5 · LXL04_020491 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01363.28FYVE104-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020491	`PF01363.28`	FYVE	104	145	1.2e-12	48.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASS2`	Arabidopsis thaliana	Protein FREE1	54.945%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card