LXL04_020448 | RubberDandelionOmics

Gene overview

LXL04_020448

Reference: OH-1004 Chr: Chr04 Coordinates: 77838939-77841409 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

708 bp · LXL04_020448|LXL04_020448|OH1004|cDNA

ATGATCAAGTCTACCAATTATCTGATCGTGACACGAGACGATCCGGGTCTGGAACTAAATTCCCAAAACGTCTCTGATCTTAGCACCGAGTCGATGGGAAGCTCGAATTCGGGTTGTGGTTCGGCCTTTTCAAATAAACGATACAAAATTAGAGTTGCAGGTTTTGATGTCAAGCAAAGAAAAGCAATGTCGGGTGGTACTAATCTCCATTATATTTTCCAGGTTCGGTGCAAGTCTCCAAAGCATTGCAGTGCAGAAGG...

CDS

Download CDS FASTA

708 bp · LXL04_020448|LXL04_020448|OH1004|CDS

ATGATCAAGTCTACCAATTATCTGATCGTGACACGAGACGATCCGGGTCTGGAACTAAATTCCCAAAACGTCTCTGATCTTAGCACCGAGTCGATGGGAAGCTCGAATTCGGGTTGTGGTTCGGCCTTTTCAAATAAACGATACAAAATTAGAGTTGCAGGTTTTGATGTCAAGCAAAGAAAAGCAATGTCGGGTGGTACTAATCTCCATTATATTTTCCAGGTTCGGTGCAAGTCTCCAAAGCATTGCAGTGCAGAAGG...

Protein

Download Protein FASTA

235 aa · LXL04_020448|LXL04_020448|OH1004|PROTEIN

MIKSTNYLIVTRDDPGLELNSQNVSDLSTESMGSSNSGCGSAFSNKRYKIRVAGFDVKQRKAMSGGTNLHYIFQVRCKSPKHCSAEGTKVVVTDHGEGDNTDFILSVHAYNKLALPGLAKELFSYGVVDVEYKRISCHYSGYNLMLKVHEHSKFPEYLSLIAIYQAGVSEITAVEIWKENCQQWMSMRRAYGAVWDMPNPPRGQPEGAINVRIQVTDSSGSKWVQLKSLIPSEWR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020448`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020448

Location Chr04:77838939-77841409 (-)

Description Similar to EXLB1: Expansin-like B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17030`	Expansin-like B1.	No verified direct reference in this release
`At3g45960`	Expansin-like A3.	No verified direct reference in this release
`At3g45970`	Expansin-like A1.	No verified direct reference in this release
`At4g38400`	Expansin-like A2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0132200`	Expansin-like A1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020448 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009653 anatomical structure morphogenesis Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

KEGG gene cross-reference

ath:AT3G45960

ath:AT3G45970

ath:AT4G17030

ath:AT4G38400

dosa:Os03g0132200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.359

Rank 1 · LXL04_020448 · OH-1004

Cytoplasm0.215

Rank 2 · LXL04_020448 · OH-1004

Lysosome / Vacuole0.185

Rank 3 · LXL04_020448 · OH-1004

Endoplasmic reticulum0.117

Rank 4 · LXL04_020448 · OH-1004

Nucleus0.099

Rank 5 · LXL04_020448 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01357.28Expansin_C146-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020448	`PF01357.28`	Expansin_C	146	231	4e-17	62.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23547`	Arabidopsis thaliana	Expansin-like B1	51.479%	Swiss-Prot	strong database homology
`Q9LZT5`	Arabidopsis thaliana	Expansin-like A3	39.181%	Swiss-Prot	moderate database homology
`Q9LZT4`	Arabidopsis thaliana	Expansin-like A1	38.150%	Swiss-Prot	moderate database homology
`Q9SVE5`	Arabidopsis thaliana	Expansin-like A2	36.842%	Swiss-Prot	moderate database homology
`Q10S70`	Oryza sativa subsp. japonica	Expansin-like A1	37.209%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card