LXL04_020344 | RubberDandelionOmics

Gene overview

LXL04_020344

Reference: OH-1004 Chr: Chr04 Coordinates: 68480893-68481465 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · LXL04_020344|LXL04_020344|OH1004|cDNA

ATGGCATTTCCTTCATCTGACCAATTACTTAAAGTGCATTGGCATAACATGAACCCACTCGTAGTTGATTTCAATCAAATATATTTGGTGTTAAAAAGTCAGCACCACAGTGGATGGTCTGAGGATGATCTGAAAAATGCAGCTATTCAGCAATATCGTGCAAGATATTGTGGTGATTTTAGACACGAACAAATTTGGAATATCTTTAGAGATGAACCCAAATGGAAATCTACAAATAATGTATTTGGGGCATGTAGGTC...

CDS

Download CDS FASTA

573 bp · LXL04_020344|LXL04_020344|OH1004|CDS

ATGGCATTTCCTTCATCTGACCAATTACTTAAAGTGCATTGGCATAACATGAACCCACTCGTAGTTGATTTCAATCAAATATATTTGGTGTTAAAAAGTCAGCACCACAGTGGATGGTCTGAGGATGATCTGAAAAATGCAGCTATTCAGCAATATCGTGCAAGATATTGTGGTGATTTTAGACACGAACAAATTTGGAATATCTTTAGAGATGAACCCAAATGGAAATCTACAAATAATGTATTTGGGGCATGTAGGTC...

Protein

Download Protein FASTA

190 aa · LXL04_020344|LXL04_020344|OH1004|PROTEIN

MAFPSSDQLLKVHWHNMNPLVVDFNQIYLVLKSQHHSGWSEDDLKNAAIQQYRARYCGDFRHEQIWNIFRDEPKWKSTNNVFGACRSSSTVQSSINLDNEEATTRPIGRNAAKQAGKGKAANSSSSSNSRLDEIFEKHIEGNQKSFERYQSSLDTKNELKGKKLKIKEEKLKNEEIAVIFMDPSTISEDR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020344`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020344

Location Chr04:68480893-68481465 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q8L727`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020344 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009407 toxin catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0004364 glutathione transferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G41240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · LXL04_020344 · OH-1004

Cytoplasm0.164

Rank 2 · LXL04_020344 · OH-1004

Mitochondrion0.017

Rank 3 · LXL04_020344 · OH-1004

Cell membrane0.012

Rank 4 · LXL04_020344 · OH-1004

Extracellular0.011

Rank 5 · LXL04_020344 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14303.13NAM-associated60-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020344	`PF14303.13`	NAM-associated	60	189	9.9e-10	40.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L727`	Arabidopsis thaliana	Glutathione S-transferase T2	31.034%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card