LXL04_020296 | RubberDandelionOmics

Gene overview

LXL04_020296

Reference: OH-1004 Chr: Chr04 Coordinates: 64455882-64464244 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4128 bp · LXL04_020296|LXL04_020296|OH1004|cDNA

ATGCATGGAAAGaaaagagaagaaaaagaaaggtCTTCTAGGGTGGTTAAGCATGTTGGCACTCAAGGGACATGCAAGTACTCTATTGAGAAGACATGTTCTTTGGAATTTGGAATTTGCATGGGCATGGGGAGAGTGGTTGTGGCTGATTTCAAGAAGAGGGAAAGGGGAGGGACCCCTTCGTTGACTtctgttgacttattgaccaaaaatGTCGGTTGTCACACCAAAGTTGCCTTGCCAGCAGCTGGTCCATATTG...

CDS

Download CDS FASTA

4128 bp · LXL04_020296|LXL04_020296|OH1004|CDS

ATGCATGGAAAGAAAAGAGAAGAAAAAGAAAGGTCTTCTAGGGTGGTTAAGCATGTTGGCACTCAAGGGACATGCAAGTACTCTATTGAGAAGACATGTTCTTTGGAATTTGGAATTTGCATGGGCATGGGGAGAGTGGTTGTGGCTGATTTCAAGAAGAGGGAAAGGGGAGGGACCCCTTCGTTGACTTCTGTTGACTTATTGACCAAAAATGTCGGTTGTCACACCAAAGTTGCCTTGCCAGCAGCTGGTCCATATTG...

Protein

Download Protein FASTA

1375 aa · LXL04_020296|LXL04_020296|OH1004|PROTEIN

MHGKKREEKERSSRVVKHVGTQGTCKYSIEKTCSLEFGICMGMGRVVVADFKKRERGGTPSLTSVDLLTKNVGCHTKVALPAAGPYWLSLIATLRINTDANFQIDKLICPRAFIYKYMEPVEGLNITEPKINELLIEFYARSAKPQQEIWSCIPIKSIPRFRRIMKKKPHEVNPIYVDYELNSNGLITKDPWGVVVKITTNGVVKFGHIMMTDLYTLIPNHLIMLKKKIIAQKRNSEQDKRAVYDRICCTCNHLCLRSAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020296`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020296

Location Chr04:64455882-64464244 (+)

Description Similar to ILP1: Transcriptional repressor ILP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08550`	Transcriptional repressor regulating endoreduplication through control of A-type cyclins expression.	Increased level of polyploidy1, a conserved repressor of CYCLINA2 transcription, controls endoreduplication in Arabidopsis.2006 · DOI: 10.1105/tpc.106.043869

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020296 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000245 spliceosomal complex assembly Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0014842 regulation of skeletal muscle satellite cell proliferation Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:2000288 positive regulation of myoblast proliferation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT5G08550

hsa:6936

hsa:94104

mmu:330361

mmu:67367

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.726

Rank 1 · LXL04_020296 · OH-1004

Cytoplasm0.220

Rank 2 · LXL04_020296 · OH-1004

Cell membrane0.061

Rank 3 · LXL04_020296 · OH-1004

Endoplasmic reticulum0.050

Rank 4 · LXL04_020296 · OH-1004

Golgi apparatus0.030

Rank 5 · LXL04_020296 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15458.12NTR2574-704 aa

PF07842.18GCFC996-1057 aa

PF07842.18GCFC1067-1172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020296	`PF15458.12`	NTR2	574	704	9.6e-08	32.7
LXL04_020296	`PF07842.18`	GCFC	996	1057	9.3e-22	78.6
LXL04_020296	`PF07842.18`	GCFC	1067	1172	9.3e-22	78.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNN3`	Arabidopsis thaliana	Transcriptional repressor ILP1	47.290%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card