LXL04_020240 | RubberDandelionOmics

Gene overview

LXL04_020240

Reference: OH-1004 Chr: Chr04 Coordinates: 59478062-59480461 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1155 bp · LXL04_020240|LXL04_020240|OH1004|cDNA

ATGGCAGAGGCCGATTCGGTGGTCGACGAGTCTTCGGTGGTCACTGTTTCGGTTGTGGCAGCTTTAACGAAAGACCTCCTGACCAAGTTATTTTACCACAACCATGTTGATTTTGAATCTCGATGTATTGCTAATTTTGCTGAGGTTTCCGCATTGGTTGACGTCTATGAAGGAGAGGCAGTGACAAAGCTCATAAACGAGAAAATACCTTACTTCAATGCCTCCATTTACCTTCAAAATAAAACTCAAATAGGCAAAGT...

CDS

Download CDS FASTA

1155 bp · LXL04_020240|LXL04_020240|OH1004|CDS

ATGGCAGAGGCCGATTCGGTGGTCGACGAGTCTTCGGTGGTCACTGTTTCGGTTGTGGCAGCTTTAACGAAAGACCTCCTGACCAAGTTATTTTACCACAACCATGTTGATTTTGAATCTCGATGTATTGCTAATTTTGCTGAGGTTTCCGCATTGGTTGACGTCTATGAAGGAGAGGCAGTGACAAAGCTCATAAACGAGAAAATACCTTACTTCAATGCCTCCATTTACCTTCAAAATAAAACTCAAATAGGCAAAGT...

Protein

Download Protein FASTA

384 aa · LXL04_020240|LXL04_020240|OH1004|PROTEIN

MAEADSVVDESSVVTVSVVAALTKDLLTKLFYHNHVDFESRCIANFAEVSALVDVYEGEAVTKLINEKIPYFNASIYLQNKTQIGKVDEIFGLKGSQSDGRIFGHLPDIYARAPVLPMAIRQDTIVAIRKRDAWESEKLLRHANVNDKYTMCTYHVHPDQNFSVSGDDHILGSKLKFPSHCTIKMSSSAQDPFYILKEEIQDSIHALQGTFHQLELTPVANGSQNRLTKEVISKCESIEWQIHALQGTFHQLEHTPVANG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020240`
TK1151 ID	TkA07G207640
OH-1004 ID	LXL04_020240
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020240

Location Chr04:59478062-59480461 (-)

Description Similar to GAL1: Galactokinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06580`	Sugar-1-kinase with a very high substrate specificity for the alpha-anomeric configuration of D-galacose (D-Gal).	No verified direct reference in this release
`At1g28490`	Vesicle trafficking protein that functions in the secretory pathway.	OSM1/SYP61: a syntaxin protein in Arabidopsis controls abscisic acid-mediated and non-abscisic acid-mediated responses to abiotic stress.2002 · DOI: 10.1105/tpc.006981 YKT6 is a core constituent of membrane fusion machineries at the Arabidopsis trans-Golgi network.2005 · DOI: 10.1016/j.jmb.2005.04.061 Isolation and proteomic analysis of the SYP61 compartment reveal its role in exocytic trafficking in Arabidopsis.2012 · DOI: 10.1038/cr.2011.129 Arabidopsis SNAREs SYP61 and SYP121 coordinate the trafficking of plasma membrane aquaporin PIP2;7 to modulate the cell membrane water permeability.2014 · DOI: 10.1105/tpc.114.127159 CESA TRAFFICKING INHIBITOR inhibits cellulose deposition and interferes with the trafficking of cellulose synthase complexes and their associated proteins KORRIGAN1 and POM2/CELLULOSE SYNTHASE INTERACTIVE PROTEIN1.2015 · DOI: 10.1104/pp.114.249003
`At3g03920`	Required for ribosome biogenesis.	No verified direct reference in this release
`At5g18180`	Required for ribosome biogenesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020240 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000454 snoRNA guided rRNA pseudouridine synthesis Biological Process

GO:0006012 galactose metabolic process Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006887 exocytosis Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0031120 snRNA pseudouridine synthesis Biological Process

GO:0046835 carbohydrate phosphorylation Biological Process

GO:0048193 Golgi vesicle transport Biological Process

GO:0048278 vesicle docking Biological Process

GO:0052324 plant-type cell wall cellulose biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G28490

ath:AT3G03920

ath:AT3G06580

ath:AT5G18180

pic:PICST_75322

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.456

Rank 1 · LXL04_020240 · OH-1004

Nucleus0.344

Rank 2 · LXL04_020240 · OH-1004

Mitochondrion0.138

Rank 3 · LXL04_020240 · OH-1004

Cell membrane0.134

Rank 4 · LXL04_020240 · OH-1004

Endoplasmic reticulum0.103

Rank 5 · LXL04_020240 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04410.21Gar148-92 aa

PF09177.16STX6_10_61_N191-262 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020240	`PF04410.21`	Gar1	48	92	1.4e-10	41.5
LXL04_020240	`PF09177.16`	STX6_10_61_N	191	262	3.7e-10	40.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SEE5`	Arabidopsis thaliana	Galactokinase	45.794%	Swiss-Prot	weak database homology
`Q946Y7`	Arabidopsis thaliana	Syntaxin-61	39.604%	Swiss-Prot	weak database homology
`Q8VZT0`	Arabidopsis thaliana	Putative H/ACA ribonucleoprotein complex subunit 1-like protein 1	73.333%	Swiss-Prot	weak database homology
`Q9FK53`	Arabidopsis thaliana	H/ACA ribonucleoprotein complex subunit 1-like protein 2	68.889%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card