LXL04_020237 | RubberDandelionOmics

Gene overview

LXL04_020237

Reference: OH-1004 Chr: Chr04 Coordinates: 59256009-59260757 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

912 bp · LXL04_020237|LXL04_020237|OH1004|cDNA

atgatgaaagcattaaacaattcccggACAAATTACTACTTCAATGCCCTAAACTGGAATGTATCCAATAACTCTGTTCCATTAGAAGACCGATATTTTTGCAAAAGAATGGCTGATGGTTCCAAGAGATTAATATTGGATGATGAGAAAGAGAcCCTTCTCTTGATGCAGTGGGATACAGCTGGCCAAGAGTGGGTTCATACTATAACAAGCGAGGAGTACATGGGGATCATTATTGTGTATGATGTCACTGACATGGA...

CDS

Download CDS FASTA

912 bp · LXL04_020237|LXL04_020237|OH1004|CDS

ATGATGAAAGCATTAAACAATTCCCGGACAAATTACTACTTCAATGCCCTAAACTGGAATGTATCCAATAACTCTGTTCCATTAGAAGACCGATATTTTTGCAAAAGAATGGCTGATGGTTCCAAGAGATTAATATTGGATGATGAGAAAGAGACCCTTCTCTTGATGCAGTGGGATACAGCTGGCCAAGAGTGGGTTCATACTATAACAAGCGAGGAGTACATGGGGATCATTATTGTGTATGATGTCACTGACATGGA...

Protein

Download Protein FASTA

303 aa · LXL04_020237|LXL04_020237|OH1004|PROTEIN

MMKALNNSRTNYYFNALNWNVSNNSVPLEDRYFCKRMADGSKRLILDDEKETLLLMQWDTAGQEWVHTITSEEYMGIIIVYDVTDMESFNNVKQWLSEIDRYANESVCKLLVGNKCDLIENKVVDTQTAKAFADELGIPFLETSAKDSVNVEQAFLTMAAEIKKNHWVIRNQGALFKLKGNQLSRRAIVVCWDLLRTHIFPRTRELPQFPISPKPLFLSKNRLRNPPKPVLKQNKKLCTYAPKKSLHICKVFGKKKSFFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020237`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020237

Location Chr04:59256009-59260757 (-)

Description Similar to RABD1: Ras-related protein RABD1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11730`	Protein transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020237 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0001675 acrosome assembly Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0006914 autophagy Biological Process

GO:0007030 Golgi organization Biological Process

GO:0015031 protein transport Biological Process

GO:0016477 cell migration Biological Process

GO:0019068 virion assembly Biological Process

GO:0030252 growth hormone secretion Biological Process

GO:0032402 melanosome transport Biological Process

KEGG gene cross-reference

ath:AT3G11730

mmu:19324

rno:81754

zma:542531

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.386

Rank 1 · LXL04_020237 · OH-1004

Mitochondrion0.282

Rank 2 · LXL04_020237 · OH-1004

Nucleus0.218

Rank 3 · LXL04_020237 · OH-1004

Endoplasmic reticulum0.091

Rank 4 · LXL04_020237 · OH-1004

Cell membrane0.086

Rank 5 · LXL04_020237 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08477.20Roc46-117 aa

PF00071.29Ras49-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020237	`PF08477.20`	Roc	46	117	7e-12	46.4
LXL04_020237	`PF00071.29`	Ras	49	163	1.8e-35	122.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZRE2`	Arabidopsis thaliana	Ras-related protein RABD1	68.841%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card