LXL04_020101 | RubberDandelionOmics

Gene overview

LXL04_020101

Reference: OH-1004 Chr: Chr04 Coordinates: 51688811-51691480 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2670 bp · LXL04_020101|LXL04_020101|OH1004|cDNA

ATGGCGGATGCTGTGGTTGAATTTCTGTTAGAGAATCTAAAACAACTGCTACTCTACAACTCGGATTTAATATATGGCGTAAAGGGCCAAGTAGATTCTCTCCATAGAGAGCTTAGTTTAATGAATGCATTCCTAAAAGACGCAAAAGAGAAACGTAACGAATATAAATACGTACGAGAATTAGTCGGACAAATAAGAGACGTGGCTTACGAAGCAGAGGACATCATCGACACATTTGTAGTTAACGCAACCATGCAGAA...

CDS

Download CDS FASTA

2670 bp · LXL04_020101|LXL04_020101|OH1004|CDS

ATGGCGGATGCTGTGGTTGAATTTCTGTTAGAGAATCTAAAACAACTGCTACTCTACAACTCGGATTTAATATATGGCGTAAAGGGCCAAGTAGATTCTCTCCATAGAGAGCTTAGTTTAATGAATGCATTCCTAAAAGACGCAAAAGAGAAACGTAACGAATATAAATACGTACGAGAATTAGTCGGACAAATAAGAGACGTGGCTTACGAAGCAGAGGACATCATCGACACATTTGTAGTTAACGCAACCATGCAGAA...

Protein

Download Protein FASTA

889 aa · LXL04_020101|LXL04_020101|OH1004|PROTEIN

MADAVVEFLLENLKQLLLYNSDLIYGVKGQVDSLHRELSLMNAFLKDAKEKRNEYKYVRELVGQIRDVAYEAEDIIDTFVVNATMQKERSTFNKIVHVFDYPTKLRSVAKDIEAIKTKMKEIYDNKMFGIEALHTPEYSNKPSSSKRRKPMVEEDNVVGFDEEATEIVSRLTSNISESLEVVSVVGMGGLGKTTLAKKVFCDPVIEFHFFVRCWVYVSQEYNRKEVLVAILSSVIQPCEQIYKLNEEMLVEEIYKHLHGR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020101`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020101

Location Chr04:51688811-51691480 (+)

Description Similar to RPP8L2: Probable disease resistance RPP8-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53350`	Potential disease resistance protein.	No verified direct reference in this release
`At5g48620`	Potential disease resistance protein.	No verified direct reference in this release
`UniProt: P59584`	Disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020101 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0051607 defense response to virus Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G53350

ath:AT5G48620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.608

Rank 1 · LXL04_020101 · OH-1004

Cytoplasm0.169

Rank 2 · LXL04_020101 · OH-1004

Endoplasmic reticulum0.096

Rank 3 · LXL04_020101 · OH-1004

Nucleus0.088

Rank 4 · LXL04_020101 · OH-1004

Plastid0.063

Rank 5 · LXL04_020101 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18052.7Rx_N5-92 aa

PF00931.29NB-ARC166-332 aa

PF13401.13AAA_22182-287 aa

PF23559.2WHD_DRP418-489 aa

PF23598.2LRR_14537-828 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020101	`PF18052.7`	Rx_N	5	92	7.6e-23	81.1
LXL04_020101	`PF00931.29`	NB-ARC	166	332	1.1e-43	149.5
LXL04_020101	`PF13401.13`	AAA_22	182	287	6.8e-06	27.1
LXL04_020101	`PF23559.2`	WHD_DRP	418	489	1.8e-20	73.4
LXL04_020101	`PF23598.2`	LRR_14	537	828	1e-15	58.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C8S1`	Arabidopsis thaliana	Probable disease resistance RPP8-like protein 2	32.075%	Swiss-Prot	moderate database homology
`Q9FJK8`	Arabidopsis thaliana	Probable disease resistance RPP8-like protein 4	31.008%	Swiss-Prot	moderate database homology
`P59584`	Arabidopsis thaliana	Disease resistance protein RPH8A	31.188%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card