Gene Card
Gene overview
cDNA / CDS / Protein Sequences
831 bp · LXL04_019968|LXL04_019968|OH1004|cDNA
ATGATCATTGATCAGCCCACAAAAGCAGAGGAAGATCAAGAGACAAGAGAGGAAAAAGAAAAAGGCGGAAAGGGCACAATGCGTTTCACAGACTCGCCGGTGATCGACCTCACTGTCAACAACTCGAAGCTTTCATTTCATCAAGACAATGGTTCAATGCACGTTGGAACCACCGTTTGGCCTGCTTCACTCGTTCTCGTCAAATTCGCCGAGCGTTGGCTCTCTTCCACTTCCACCACCGACAACCCCTACGCAACCGT...
831 bp · LXL04_019968|LXL04_019968|OH1004|CDS
ATGATCATTGATCAGCCCACAAAAGCAGAGGAAGATCAAGAGACAAGAGAGGAAAAAGAAAAAGGCGGAAAGGGCACAATGCGTTTCACAGACTCGCCGGTGATCGACCTCACTGTCAACAACTCGAAGCTTTCATTTCATCAAGACAATGGTTCAATGCACGTTGGAACCACCGTTTGGCCTGCTTCACTCGTTCTCGTCAAATTCGCCGAGCGTTGGCTCTCTTCCACTTCCACCACCGACAACCCCTACGCAACCGT...
Protein
Download Protein FASTA276 aa · LXL04_019968|LXL04_019968|OH1004|PROTEIN
MIIDQPTKAEEDQETREEKEKGGKGTMRFTDSPVIDLTVNNSKLSFHQDNGSMHVGTTVWPASLVLVKFAERWLSSTSTTDNPYATVLHFQNKRAVELGTGCGVAAMGLYLLGLKDVVLTDIAPVMPALKHNLKRNKTVLGKMLKTAQLHWTNSDQIKALKPPFDIVVAADVVYIEESVGPLLAAMESMVSDTGVVLLGYQVRSPEAHLLFWEQCNRIFEVEKVPHDHLHPEYAYEETNYPTPNISAAWENTSKSKEKRS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_019968 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_019968 |
|---|---|
| Location | Chr04:46135488-46137062 (-) |
| Description | Similar to VCPKMT: Protein-lysine methyltransferase METTL21D |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006479 protein methylation Biological Process GO:0018022 peptidyl-lysine methylation Biological Process GO:0018023 peptidyl-lysine trimethylation Biological Process GO:0032259 methylation Biological Process GO:0032780 negative regulation of ATP-dependent activity Biological Process GO:1903333 negative regulation of protein folding Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0032991 protein-containing complex Cellular Component GO:0008276 protein methyltransferase activity Molecular Function GO:0016279 protein-lysine N-methyltransferase activity Molecular Function |
| KEGG gene cross-reference | cel:CELE_C42C1.13 hsa:151194 hsa:79609 mmu:207965 xtr:100038275 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF10294.16Methyltransf_1640-205 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_019968 | PF10294.16 | Methyltransf_16 | 40 | 205 | 4.2e-27 | 95.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.