LXL04_019838 | RubberDandelionOmics

Gene overview

LXL04_019838

Reference: OH-1004 Chr: Chr04 Coordinates: 41456757-41458814 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

534 bp · LXL04_019838|LXL04_019838|OH1004|cDNA

ATGAAAGGGCCTTTCGttgccaccaccaccaccgcacCAAGATTCATTGCTATCGAGGCTGTCTCGCTCCAGTTCTTCAATTCTCAAGGGTATCTGGTTATTGAATCTTTCTCAAGTTCCGAAGAGGTTGAAGCGTTAAGAAAGAGGATGGACCAATTGCTGGATGGCTTCGATTGCTCTTCCTCTACCTCAATTTTCTCCACCAAGAACCAGCAAAGGACAAGCGATGACTACTTCTATGACAGCGCTGACAAAATATC...

CDS

Download CDS FASTA

534 bp · LXL04_019838|LXL04_019838|OH1004|CDS

ATGAAAGGGCCTTTCGTTGCCACCACCACCACCGCACCAAGATTCATTGCTATCGAGGCTGTCTCGCTCCAGTTCTTCAATTCTCAAGGGTATCTGGTTATTGAATCTTTCTCAAGTTCCGAAGAGGTTGAAGCGTTAAGAAAGAGGATGGACCAATTGCTGGATGGCTTCGATTGCTCTTCCTCTACCTCAATTTTCTCCACCAAGAACCAGCAAAGGACAAGCGATGACTACTTCTATGACAGCGCTGACAAAATATC...

Protein

Download Protein FASTA

177 aa · LXL04_019838|LXL04_019838|OH1004|PROTEIN

MKGPFVATTTTAPRFIAIEAVSLQFFNSQGYLVIESFSSSEEVEALRKRMDQLLDGFDCSSSTSIFSTKNQQRTSDDYFYDSADKISFFFEGSFMPYLEHMIQFFVFYVLIFSNYLTEKAFDDDGNLKQPKQLSINKVGHAIEDLFQVLSIKSLTELEGTSQDGGTEVQVSTFAGNF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019838`
TK1151 ID	TkA07G058690
OH-1004 ID	LXL04_019838
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	78.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019838

Location Chr04:41456757-41458814 (-)

Description Similar to PAHX: Phytanoyl-CoA dioxygenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01490`	Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0708100`	Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.	No verified direct reference in this release
`Os05g0473900`	Converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019838 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0031418 L-ascorbic acid binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0048244 phytanoyl-CoA dioxygenase activity Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT2G01490

ddi:DDB_G0278961

dosa:Os03g0708100

dosa:Os05g0473900

osa:4339087

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.554

Rank 1 · LXL04_019838 · OH-1004

Nucleus0.494

Rank 2 · LXL04_019838 · OH-1004

Endoplasmic reticulum0.072

Rank 3 · LXL04_019838 · OH-1004

Mitochondrion0.058

Rank 4 · LXL04_019838 · OH-1004

Cell membrane0.049

Rank 5 · LXL04_019838 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05721.20PhyH26-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019838	`PF05721.20`	PhyH	26	94	8.3e-06	26.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVF6`	Arabidopsis thaliana	Phytanoyl-CoA dioxygenase	58.537%	Swiss-Prot	moderate database homology
`Q10E49`	Oryza sativa subsp. japonica	Phytanoyl-CoA dioxygenase 1	46.825%	Swiss-Prot	moderate database homology
`Q65WW7`	Oryza sativa subsp. japonica	Phytanoyl-CoA dioxygenase 2	47.154%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card