LXL04_019832 | RubberDandelionOmics

Gene overview

LXL04_019832

Reference: OH-1004 Chr: Chr04 Coordinates: 41312215-41325700 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3300 bp · LXL04_019832|LXL04_019832|OH1004|cDNA

ATGCACGCTTCTCTGCCACCTGCCACTACCTTGCACGCCTTCTTTCTCTCCACGCTTGCACAGCCTCCGATTCCATTTCAAATTGCAATCGATTCATACAAAATCGATTCATATAAAATCGGCTCGGTTCACTCTTTTGGAACTGCAATTTCTATCGATTCATACAAAATCGGCTCGGTTTTGATCGAAGGTCTGGACCACAAACAAGTTTACGTTCAGGGCACCCCTCGATCTTCAAGAAGACTTTTGCGGCACTGCTC...

CDS

Download CDS FASTA

3300 bp · LXL04_019832|LXL04_019832|OH1004|CDS

ATGCACGCTTCTCTGCCACCTGCCACTACCTTGCACGCCTTCTTTCTCTCCACGCTTGCACAGCCTCCGATTCCATTTCAAATTGCAATCGATTCATACAAAATCGATTCATATAAAATCGGCTCGGTTCACTCTTTTGGAACTGCAATTTCTATCGATTCATACAAAATCGGCTCGGTTTTGATCGAAGGTCTGGACCACAAACAAGTTTACGTTCAGGGCACCCCTCGATCTTCAAGAAGACTTTTGCGGCACTGCTC...

Protein

Download Protein FASTA

1099 aa · LXL04_019832|LXL04_019832|OH1004|PROTEIN

MHASLPPATTLHAFFLSTLAQPPIPFQIAIDSYKIDSYKIGSVHSFGTAISIDSYKIGSVLIEGLDHKQVYVQGTPRSSRRLLRHCSSQVLIERLDHKQVYVQGTPPSSRRLLRHYSSQIKAKQVKPNGAGLLSLRFNVMLITFWDALMQLVSCAFLYRFCLCLHSGRKVYINTWSSSEAWTGGFTVLNPKGRIWTTVAGGGASVIYADTVGDLGYASELGNYAEYSGAPNEEEVLQYARVVIDCATADPDGQKRALVVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019832`
TK1151 ID	TkA02G070760
OH-1004 ID	LXL04_019832
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.100
Protein coverage (%)	TK1151 28.333 / OH-1004 4.641 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019832

Location Chr04:41312215-41325700 (-)

Description Similar to ACLA-2: ATP-citrate synthase alpha chain protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60810`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	No verified direct reference in this release
`At1g09430`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	No verified direct reference in this release
`At1g10670`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	Molecular characterization of a heteromeric ATP-citrate lyase that generates cytosolic acetyl-coenzyme A in Arabidopsis.2002 · DOI: 10.1104/pp.008110

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0566300`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	No verified direct reference in this release
`Os11g0696200`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019832 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006085 acetyl-CoA biosynthetic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0140615 ATP-dependent citrate lyase complex Cellular Component

GO:0003878 ATP citrate synthase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G09430

ath:AT1G60810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.682

Rank 1 · LXL04_019832 · OH-1004

Nucleus0.425

Rank 2 · LXL04_019832 · OH-1004

Mitochondrion0.082

Rank 3 · LXL04_019832 · OH-1004

Endoplasmic reticulum0.066

Rank 4 · LXL04_019832 · OH-1004

Cell membrane0.052

Rank 5 · LXL04_019832 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16114.11Citrate_bind185-324 aa

PF16114.11Citrate_bind414-552 aa

PF16114.11Citrate_bind676-815 aa

PF16114.11Citrate_bind939-1093 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019832	`PF16114.11`	Citrate_bind	185	324	6e-270	886.5
LXL04_019832	`PF16114.11`	Citrate_bind	414	552	6e-270	886.5
LXL04_019832	`PF16114.11`	Citrate_bind	676	815	6e-270	886.5
LXL04_019832	`PF16114.11`	Citrate_bind	939	1093	6e-270	886.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22718`	Arabidopsis thaliana	ATP-citrate synthase alpha chain protein 2	79.121%	Swiss-Prot	weak database homology
`O80526`	Arabidopsis thaliana	ATP-citrate synthase alpha chain protein 3	80.114%	Swiss-Prot	weak database homology
`Q9SGY2`	Arabidopsis thaliana	ATP-citrate synthase alpha chain protein 1	88.199%	Swiss-Prot	weak database homology
`Q2QNG7`	Oryza sativa subsp. japonica	ATP-citrate synthase alpha chain protein 3	79.444%	Swiss-Prot	weak database homology
`Q2QZ86`	Oryza sativa subsp. japonica	ATP-citrate synthase alpha chain protein 2	80.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card