LXL04_019824 | RubberDandelionOmics

Gene overview

LXL04_019824

Reference: OH-1004 Chr: Chr04 Coordinates: 41122467-41122851 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

318 bp · LXL04_019824|LXL04_019824|OH1004|cDNA

ATGTCAAACCACAACAACATCAACTGGTACATCAATAACTATAATGAATGTCAAACCACAACAGATTCTCTTCTTGATGAATACCTTTTAAAGGATAAGTCTGAACAAAGTGATGCAGTGTCTTCATATCCACAGAAGTGTCTAATTACTTGTGATGTTAAAATGAAGGAAGCTGTGAAGGGTAGTAATGACATTTATGTGTCAAATGATGGAATGGTTTTTCTTGATTTCTTGGAAGCCATTCACACAGCTGAAAAAAG...

CDS

Download CDS FASTA

318 bp · LXL04_019824|LXL04_019824|OH1004|CDS

ATGTCAAACCACAACAACATCAACTGGTACATCAATAACTATAATGAATGTCAAACCACAACAGATTCTCTTCTTGATGAATACCTTTTAAAGGATAAGTCTGAACAAAGTGATGCAGTGTCTTCATATCCACAGAAGTGTCTAATTACTTGTGATGTTAAAATGAAGGAAGCTGTGAAGGGTAGTAATGACATTTATGTGTCAAATGATGGAATGGTTTTTCTTGATTTCTTGGAAGCCATTCACACAGCTGAAAAAAG...

Protein

Download Protein FASTA

105 aa · LXL04_019824|LXL04_019824|OH1004|PROTEIN

MSNHNNINWYINNYNECQTTTDSLLDEYLLKDKSEQSDAVSSYPQKCLITCDVKMKEAVKGSNDIYVSNDGMVFLDFLEAIHTAEKRQEELDAYFKFFYVTTFDL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019824`
TK1151 ID	TkA06G263190
OH-1004 ID	LXL04_019824
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019824

Location Chr04:41122467-41122851 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39690`	Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane (By similarity).	AtMic60 Is Involved in Plant Mitochondria Lipid Trafficking and Is Part of a Large Complex.2016 · DOI: 10.1016/j.cub.2016.01.011

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019824 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0032368 regulation of lipid transport Biological Process

GO:0042407 cristae formation Biological Process

GO:0097035 regulation of membrane lipid distribution Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0061617 MICOS complex Cellular Component

GO:0098800 inner mitochondrial membrane protein complex Cellular Component

GO:1901612 cardiolipin binding Molecular Function

KEGG gene cross-reference

ath:AT4G39690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.437

Rank 1 · LXL04_019824 · OH-1004

Cytoplasm0.419

Rank 2 · LXL04_019824 · OH-1004

Mitochondrion0.116

Rank 3 · LXL04_019824 · OH-1004

Extracellular0.070

Rank 4 · LXL04_019824 · OH-1004

Cell membrane0.068

Rank 5 · LXL04_019824 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASV5`	Arabidopsis thaliana	MICOS complex subunit MIC60, mitochondrial	41.667%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card