LXL04_019681 | RubberDandelionOmics

Gene overview

LXL04_019681

Reference: OH-1004 Chr: Chr04 Coordinates: 36856232-36859433 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1176 bp · LXL04_019681|LXL04_019681|OH1004|cDNA

ATGGCGGATTTGCTTCAACAACACGAAACCTTCGTTCTACTCCAGCTTCAGCTTCGTTTCCCCTTCGTAGCTTCCAACTTCAGCTACTGCTCGTGTAAATTGAATGCCCAGCAACCATTACCAGATTGCGAAGGTTTGGACCCATGGAAGTTTTTCAGTTCAGTTCATCAAATGTCAGAGAAATTGCCGCTTAGAGCCATGCATTCTGACAATGAATTAAGGCAAACCGTAACTACAGTTGGATCACAGCGCATTGTTAC...

CDS

Download CDS FASTA

1176 bp · LXL04_019681|LXL04_019681|OH1004|CDS

ATGGCGGATTTGCTTCAACAACACGAAACCTTCGTTCTACTCCAGCTTCAGCTTCGTTTCCCCTTCGTAGCTTCCAACTTCAGCTACTGCTCGTGTAAATTGAATGCCCAGCAACCATTACCAGATTGCGAAGGTTTGGACCCATGGAAGTTTTTCAGTTCAGTTCATCAAATGTCAGAGAAATTGCCGCTTAGAGCCATGCATTCTGACAATGAATTAAGGCAAACCGTAACTACAGTTGGATCACAGCGCATTGTTAC...

Protein

Download Protein FASTA

391 aa · LXL04_019681|LXL04_019681|OH1004|PROTEIN

MADLLQQHETFVLLQLQLRFPFVASNFSYCSCKLNAQQPLPDCEGLDPWKFFSSVHQMSEKLPLRAMHSDNELRQTVTTVGSQRIVTLSVDRYLDIHILKKKVLTSSDVKEGFGITLTKTMAKSKKNLHSINNVKKACQCCFVILGPKGTPVPLQIKTPPSYIKIDPNQTLKVINNGVTISIAIEFSDSIENAWAIVIQEDPFIRPKLCLTRLKISDSEMANPKVFFDMTVGGAPVGKIVMELYADTTPKTAENFRALCT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019681`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019681

Location Chr04:36856232-36859433 (-)

Description Similar to CYP19-2: Peptidyl-prolyl cis-trans isomerase CYP19-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21130`	PPIases accelerate the folding of proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019681 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010555 response to mannitol Biological Process

GO:0061083 regulation of protein refolding Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:1902074 response to salt Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003755 peptidyl-prolyl cis-trans isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT2G21130

gmx:106795232

sly:100736432

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.302

Rank 1 · LXL04_019681 · OH-1004

Cytoplasm0.293

Rank 2 · LXL04_019681 · OH-1004

Nucleus0.185

Rank 3 · LXL04_019681 · OH-1004

Mitochondrion0.158

Rank 4 · LXL04_019681 · OH-1004

Cell membrane0.090

Rank 5 · LXL04_019681 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00160.27Pro_isomerase226-388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019681	`PF00160.27`	Pro_isomerase	226	388	4.1e-50	170.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKQ0`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase CYP19-2	85.882%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card