LXL04_019580 | RubberDandelionOmics

Gene overview

LXL04_019580

Reference: OH-1004 Chr: Chr04 Coordinates: 34450267-34451202 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

393 bp · LXL04_019580|LXL04_019580|OH1004|cDNA

ATGCTCCTAATTCAGGCACAACAAAGTTTATATGACAAAAAAACCTTCAATATTGGTCGAATAGAAACTTCAAATTCAAAACTTGTGTTTTGGGACCTTGGAGGTCAGTCTGGTCTTCGGTCAATTTGGGAGAAATATTATGAGGAGGCACATGCTGTTATCTTTGTAGTTGATGCTTCTTGTCCTTCGCGTTTTGAAGAGTCCAAATCTGCCCTTGAAAAGGTGCTTAGGCATGAGGATCTGCAAGGTGCCCCTCTTCT...

CDS

Download CDS FASTA

393 bp · LXL04_019580|LXL04_019580|OH1004|CDS

ATGCTCCTAATTCAGGCACAACAAAGTTTATATGACAAAAAAACCTTCAATATTGGTCGAATAGAAACTTCAAATTCAAAACTTGTGTTTTGGGACCTTGGAGGTCAGTCTGGTCTTCGGTCAATTTGGGAGAAATATTATGAGGAGGCACATGCTGTTATCTTTGTAGTTGATGCTTCTTGTCCTTCGCGTTTTGAAGAGTCCAAATCTGCCCTTGAAAAGGTGCTTAGGCATGAGGATCTGCAAGGTGCCCCTCTTCT...

Protein

Download Protein FASTA

130 aa · LXL04_019580|LXL04_019580|OH1004|PROTEIN

MLLIQAQQSLYDKKTFNIGRIETSNSKLVFWDLGGQSGLRSIWEKYYEEAHAVIFVVDASCPSRFEESKSALEKVLRHEDLQGAPLLILANKQSRSIWNDKPAFEEKTMLSTVAIWAREFLDIYMDDAAV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019580`
TK1151 ID	TkA05G066320
OH-1004 ID	LXL04_019580
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	95.100
Protein coverage (%)	TK1151 91.964 / OH-1004 79.231 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_019580`
Location	Chr04:34450267-34451202 (+)
Description	Similar to Arfrp1: ADP-ribosylation factor-related protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019580` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006886 intracellular protein transport Biological Process GO:0007165 signal transduction Biological Process GO:0034067 protein localization to Golgi apparatus Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:0043001 Golgi to plasma membrane protein transport Biological Process GO:0005794 Golgi apparatus Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0032588 trans-Golgi network membrane Cellular Component GO:0003924 GTPase activity Molecular Function GO:0005525 GTP binding Molecular Function
KEGG gene cross-reference	bta:525394 hsa:10139 mmu:76688 pon:100444340 rno:117051 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.541

Rank 1 · LXL04_019580 · OH-1004

Nucleus0.321

Rank 2 · LXL04_019580 · OH-1004

Mitochondrion0.118

Rank 3 · LXL04_019580 · OH-1004

Cell membrane0.101

Rank 4 · LXL04_019580 · OH-1004

Golgi apparatus0.101

Rank 5 · LXL04_019580 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08477.20Roc11-92 aa

PF00025.28Arf13-113 aa

PF00071.29Ras20-93 aa

PF00503.27G-alpha20-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019580	`PF08477.20`	Roc	11	92	2.8e-08	34.7
LXL04_019580	`PF00025.28`	Arf	13	113	9.5e-27	94.3
LXL04_019580	`PF00071.29`	Ras	20	93	6.3e-07	29.8
LXL04_019580	`PF00503.27`	G-alpha	20	92	3.1e-06	27.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card