LXL04_019343 | RubberDandelionOmics

Gene overview

LXL04_019343

Reference: OH-1004 Chr: Chr04 Coordinates: 29318272-29320314 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

576 bp · LXL04_019343|LXL04_019343|OH1004|cDNA

ATGGGATTCCGATCTGTCTTCTTCGCTCGATCTGTCTCTTTCAACGACTGGTTCGAACTTTGCAGCCTCTTTCCTCTTTCATCTCGGATTTCAGATCTCAAGCTTCCGATTTTAAGCAGTTATAGTTCCGATTTGTTTGTGATTctatttGGATACAACGGATCACAGTTATGGGATGTTGTTTTCTCTGTTCAAGCAATAGTAGCAACCAATCTTGTTGATGAATACAGATCCATGCTTCATAAAGCACACGACTTCAT...

CDS

Download CDS FASTA

576 bp · LXL04_019343|LXL04_019343|OH1004|CDS

ATGGGATTCCGATCTGTCTTCTTCGCTCGATCTGTCTCTTTCAACGACTGGTTCGAACTTTGCAGCCTCTTTCCTCTTTCATCTCGGATTTCAGATCTCAAGCTTCCGATTTTAAGCAGTTATAGTTCCGATTTGTTTGTGATTCTATTTGGATACAACGGATCACAGTTATGGGATGTTGTTTTCTCTGTTCAAGCAATAGTAGCAACCAATCTTGTTGATGAATACAGATCCATGCTTCATAAAGCACACGACTTCAT...

Protein

Download Protein FASTA

191 aa · LXL04_019343|LXL04_019343|OH1004|PROTEIN

MGFRSVFFARSVSFNDWFELCSLFPLSSRISDLKLPILSSYSSDLFVILFGYNGSQLWDVVFSVQAIVATNLVDEYRSMLHKAHDFIKNSQVKKNSSGNIQSWYRHISRGGWPFSTPDNGWPVSDCTAEALKTVLMLSQMPHDIVGEAIARECLYDAVYLLLTLQAAFNLLIDLNMAKLIKAFDRGSWKKD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019343`
TK1151 ID	TkA05G044770
OH-1004 ID	LXL04_019343
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019343

Location Chr04:29318272-29320314 (+)

Description Similar to CPR: Probable oxidosqualene cyclase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g07050`	Converts oxidosqualene to cycloartenol and 1% parkeol.	Allelic mutant series reveal distinct functions for Arabidopsis cycloartenol synthase 1 in cell viability and plastid biogenesis.2008 · DOI: 10.1073/pnas.0712190105 Isolation of an Arabidopsis thaliana gene encoding cycloartenol synthase by functional expression in a yeast mutant lacking lanosterol synthase by the use of a chromatographic screen.1993 · DOI: 10.1073/pnas.90.24.11628

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019343 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0010686 tetracyclic triterpenoid biosynthetic process Biological Process

GO:0016104 triterpenoid biosynthetic process Biological Process

GO:0019745 pentacyclic triterpenoid biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005811 lipid droplet Cellular Component

GO:0016871 cycloartenol synthase activity Molecular Function

GO:0031559 oxidosqualene cyclase activity Molecular Function

KEGG gene cross-reference

ath:AT2G07050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.345

Rank 1 · LXL04_019343 · OH-1004

Cytoplasm0.285

Rank 2 · LXL04_019343 · OH-1004

Mitochondrion0.174

Rank 3 · LXL04_019343 · OH-1004

Nucleus0.136

Rank 4 · LXL04_019343 · OH-1004

Endoplasmic reticulum0.070

Rank 5 · LXL04_019343 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13243.13SQHop_cyclase_C55-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019343	`PF13243.13`	SQHop_cyclase_C	55	151	8.4e-06	25.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P38605`	Arabidopsis thaliana	Cycloartenol synthase	60.684%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card