LXL04_019069 | RubberDandelionOmics

Gene overview

LXL04_019069

Reference: OH-1004 Chr: Chr04 Coordinates: 23075034-23078171 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2808 bp · LXL04_019069|LXL04_019069|OH1004|cDNA

ATGAGAATCGCCGAGATCTCTTCGCCGGATCTCCGCCAGACGCAGTCACAGGATCCGAAATCAGATGTACTTTGCAAACTAGATGCTTTAACAACTGAAATCGAACGCCACTCGCCGGAGTCTCCTTTGAAGGAGTCTGTCCCCGCTGCTCTCCGCCACGGACTGAATCAACTAACTTCACTCGCACCATTCCAGAACTCCGTGAAGCTGCAGATATGGAAGTTGAGTTACCGTTTATGGAACGCATGCGTTGATCTCTT...

CDS

Download CDS FASTA

2808 bp · LXL04_019069|LXL04_019069|OH1004|CDS

ATGAGAATCGCCGAGATCTCTTCGCCGGATCTCCGCCAGACGCAGTCACAGGATCCGAAATCAGATGTACTTTGCAAACTAGATGCTTTAACAACTGAAATCGAACGCCACTCGCCGGAGTCTCCTTTGAAGGAGTCTGTCCCCGCTGCTCTCCGCCACGGACTGAATCAACTAACTTCACTCGCACCATTCCAGAACTCCGTGAAGCTGCAGATATGGAAGTTGAGTTACCGTTTATGGAACGCATGCGTTGATCTCTT...

Protein

Download Protein FASTA

935 aa · LXL04_019069|LXL04_019069|OH1004|PROTEIN

MRIAEISSPDLRQTQSQDPKSDVLCKLDALTTEIERHSPESPLKESVPAALRHGLNQLTSLAPFQNSVKLQIWKLSYRLWNACVDLFNFVRSSSSKITEEHAKLRQCCADLLFLAIDVSGVPSPYFKCASFFYKTGIIWHELHKYDLASNCFEKATDLTSKVEITNVSDRDERRLLLDLNLARSKTAWEVSDRNLAINLLNRSKRVLFGIGENYMALANQYTNFGKLLLSKNEVSAVNEALKLMNEALELCEQGLRNVKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019069`
TK1151 ID	TkA05G016140
OH-1004 ID	LXL04_019069
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019069

Location Chr04:23075034-23078171 (-)

Description Similar to ZIP4: TPR repeat-containing protein ZIP4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48390`	Required for meiotic chromosome segregation.	Zip4/Spo22 is required for class I CO formation but not for synapsis completion in Arabidopsis thaliana.2007 · DOI: 10.1371/journal.pgen.0030083 Homologous chromosome pairing is completed in crossover defective atzip4 mutant.2008 · DOI: 10.1016/j.bbrc.2008.03.036

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WXU2`	Required for crossover formation, complete synapsis of homologous chromosomes and bivalent formation during meiosis.	No verified direct reference in this release
`Os01g0890900`	Required for crossover formation, complete synapsis of homologous chromosomes and bivalent formation during meiosis.	ZIP4 in homologous chromosome synapsis and crossover formation in rice meiosis.2012 · DOI: 10.1242/jcs.090993

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019069 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000712 resolution of meiotic recombination intermediates Biological Process

GO:0006311 meiotic gene conversion Biological Process

GO:0007060 male meiosis chromosome segregation Biological Process

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0007130 synaptonemal complex assembly Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0007143 female meiotic nuclear division Biological Process

GO:0071139 resolution of DNA recombination intermediates Biological Process

GO:0090173 regulation of synaptonemal complex assembly Biological Process

GO:0000801 central element Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT5G48390

dosa:Os01g0890800

dosa:Os01g0890900

hsa:56159

osa:4324913

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.733

Rank 1 · LXL04_019069 · OH-1004

Cytoplasm0.305

Rank 2 · LXL04_019069 · OH-1004

Mitochondrion0.038

Rank 3 · LXL04_019069 · OH-1004

Cell membrane0.027

Rank 4 · LXL04_019069 · OH-1004

Endoplasmic reticulum0.023

Rank 5 · LXL04_019069 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08631.17SPO22186-459 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019069	`PF08631.17`	SPO22	186	459	6.1e-41	141.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B0M1H3`	Arabidopsis thaliana	TPR repeat-containing protein ZIP4	56.270%	Swiss-Prot	strong database homology
`A2WXU2`	Oryza sativa subsp. indica	TPR repeat-containing protein ZIP4	41.238%	Swiss-Prot	moderate database homology
`Q5N829`	Oryza sativa subsp. japonica	TPR repeat-containing protein ZIP4	41.133%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card