LXL04_019056 | RubberDandelionOmics

Gene overview

LXL04_019056

Reference: OH-1004 Chr: Chr04 Coordinates: 22836706-22840414 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

552 bp · LXL04_019056|LXL04_019056|OH1004|cDNA

ATGGCTGAGATTGAACCTCTATTAACATCGAGGTCCTTTCCTGACTCTAATGGCGTGTCTAGGATATTCCAGGAACTGCGATTGACTATAGATCCAACCATCAATGAGGAAGGTTTTCTATCTAAAGTTGAGAGCTTGAAGGGGGTACAACATGTGGTGATACTCTCTCAGGCATTTTTCCAGCGATGGTGGAGGGACCAAAGTGAGGCAACCCAAGAGACAGTCAAGTGCCTTGGGTGGTGCATGCATGATGAGGCAGC...

CDS

Download CDS FASTA

552 bp · LXL04_019056|LXL04_019056|OH1004|CDS

ATGGCTGAGATTGAACCTCTATTAACATCGAGGTCCTTTCCTGACTCTAATGGCGTGTCTAGGATATTCCAGGAACTGCGATTGACTATAGATCCAACCATCAATGAGGAAGGTTTTCTATCTAAAGTTGAGAGCTTGAAGGGGGTACAACATGTGGTGATACTCTCTCAGGCATTTTTCCAGCGATGGTGGAGGGACCAAAGTGAGGCAACCCAAGAGACAGTCAAGTGCCTTGGGTGGTGCATGCATGATGAGGCAGC...

Protein

Download Protein FASTA

183 aa · LXL04_019056|LXL04_019056|OH1004|PROTEIN

MAEIEPLLTSRSFPDSNGVSRIFQELRLTIDPTINEEGFLSKVESLKGVQHVVILSQAFFQRWWRDQSEATQETVKCLGWCMHDEAAPHYIDMIDQTTYGHKFIKQQFNVTPKIGCEIDHFGHSAVHAHLLGAEVGFDSVFFGLIDYQDRNKRKGDKHLEVIWPGHKLLIWMFDNSLDWWIFD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019056`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019056

Location Chr04:22836706-22840414 (-)

Description Similar to At5g13980: Probable alpha-mannosidase At5g13980

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13980`	Liberates mannose from p-nitrophenyl-alpha-D-mannoside in vitro.	No verified direct reference in this release
`At5g66150`	Liberates mannose from p-nitrophenyl-alpha-D-mannoside in vitro.	No verified direct reference in this release
`At3g26720`	Liberates mannose from p-nitrophenyl-alpha-D-mannoside in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019056 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006013 mannose metabolic process Biological Process

GO:0036211 protein modification process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000326 protein storage vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0032009 early phagosome Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT3G26720

ath:AT5G13980

ath:AT5G66150

ddi:DDB_G0292206

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.575

Rank 1 · LXL04_019056 · OH-1004

Cytoplasm0.116

Rank 2 · LXL04_019056 · OH-1004

Endoplasmic reticulum0.110

Rank 3 · LXL04_019056 · OH-1004

Lysosome / Vacuole0.095

Rank 4 · LXL04_019056 · OH-1004

Nucleus0.031

Rank 5 · LXL04_019056 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01074.29Glyco_hydro_38N55-166 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019056	`PF01074.29`	Glyco_hydro_38N	55	166	2e-27	97.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPJ3`	Arabidopsis thaliana	Probable alpha-mannosidase At5g13980	65.625%	Swiss-Prot	moderate database homology
`Q9FKW9`	Arabidopsis thaliana	Probable alpha-mannosidase At5g66150	59.375%	Swiss-Prot	moderate database homology
`P94078`	Arabidopsis thaliana	Alpha-mannosidase At3g26720	60.156%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card