Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1866 bp · LXL04_019053|LXL04_019053|OH1004|cDNA
ATGCCGCCATTACCAATGGTGTGGAGGCGCTTCCTTTGCACCCAGACATCTAACTTCTCCTTCAACAAAAAACCCGGCGGTGGCCGCCGTCTTCAATGGCCTATAAAACAGGTTACTAAGTCCAATTTCTTAAATTCACTCGATGAAATTAAGAACCATATAGCGGACTCAGATTTCGTGGCGGTTTCGTTGAAGTGCACGGGCTCTTACTCGTCCCCATGGCATCGAATTCTGCCCTTCGACACCCCTGAAATCGCATA...
1866 bp · LXL04_019053|LXL04_019053|OH1004|CDS
ATGCCGCCATTACCAATGGTGTGGAGGCGCTTCCTTTGCACCCAGACATCTAACTTCTCCTTCAACAAAAAACCCGGCGGTGGCCGCCGTCTTCAATGGCCTATAAAACAGGTTACTAAGTCCAATTTCTTAAATTCACTCGATGAAATTAAGAACCATATAGCGGACTCAGATTTCGTGGCGGTTTCGTTGAAGTGCACGGGCTCTTACTCGTCCCCATGGCATCGAATTCTGCCCTTCGACACCCCTGAAATCGCATA...
Protein
Download Protein FASTA621 aa · LXL04_019053|LXL04_019053|OH1004|PROTEIN
MPPLPMVWRRFLCTQTSNFSFNKKPGGGRRLQWPIKQVTKSNFLNSLDEIKNHIADSDFVAVSLKCTGSYSSPWHRILPFDTPEIAYLKAKYAAERFQILQLAVCPFSIRASNKLTAHPFNFHLFPRDELKIGMPCYSFSCQPSYLASMARDDFDFNVCIYDGISYLSRAQESAAKSKIGNPVSSDYVAQSPSSRSVADNVFVERIKSKVGHWISACTRSVTKTDDALVNSLRKLILGGEDYGSRPSLNIDVCSERQVQL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_019053 |
|---|---|
| TK1151 ID | TkA05G015260 |
| OH-1004 ID | LXL04_019053 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_019053 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:22828514-22831359 (+) | |||||||||
| Description | Similar to At3g25430: Poly(A)-specific ribonuclease PARN-like | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening Biological Process GO:0000495 box H/ACA sno(s)RNA 3'-end processing Biological Process GO:0006397 mRNA processing Biological Process GO:0006952 defense response Biological Process GO:0006970 response to osmotic stress Biological Process GO:0007292 female gamete generation Biological Process GO:0009451 RNA modification Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009751 response to salicylic acid Biological Process GO:0010587 miRNA catabolic process Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G55870 ath:AT3G25430 hsa:5073 pon:100172259 xla:394409 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04857.27CAF138-425 aaPF28940.1RRM_PARN_C487-589 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_019053 | PF04857.27 | CAF1 | 38 | 425 | 1.4e-67 | 228.9 |
| LXL04_019053 | PF28940.1 | RRM_PARN_C | 487 | 589 | 5.7e-07 | 30.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.