LXL04_019040 | RubberDandelionOmics

Gene overview

LXL04_019040

Reference: OH-1004 Chr: Chr04 Coordinates: 22457673-22461177 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3295 bp · LXL04_019040|LXL04_019040|OH1004|cDNA

AGGGACTAAAACTGTAATGGTTTACAAAACACTTTTTATAAAATGAGAAAGTGACTCAAAGTGTTTGATTGTGGCTGATGTCTTGATTCTAGAAACAGCATCTAGATACATGGACAAGTTAAGGGGCCAATTCTGTAATATCAATCTTTATAATTATCTAAATGCTGAACGGCGAATTTGAGAGTCAAACTAATATATTTGCTTTCAAACCTCTGCAACTATCCTTATCATACatgccaccaccaccaccataaCCAACC...

CDS

Download CDS FASTA

3006 bp · LXL04_019040|LXL04_019040|OH1004|CDS

ATGCCAATACTACCCTTACCTTCTCTCCTCCTCCTCTTTTTCCTCCTACCCTTTCACGTAATTTCACAATCCACCACCACCCAAAATGACCAAAACATTCTTCTCAAAATCAAAAGCTTCTGGTCCAATCCGCCTTCCCTCAACCACTGGAACCAATCCTCCGACCCTTGCAGCTGGCCGGAGATTACATGTACCGGGACCAACATCACCGGCATCACCGTCGTTGATCAGGACATCAGCGGTACTGTTCCACCGTTCAT...

Protein

Download Protein FASTA

1001 aa · LXL04_019040|LXL04_019040|OH1004|PROTEIN

MPILPLPSLLLLFFLLPFHVISQSTTTQNDQNILLKIKSFWSNPPSLNHWNQSSDPCSWPEITCTGTNITGITVVDQDISGTVPPFICDLKNLTVLDLNYNDITGNFPAALYNCTNLRYLDLSQNYFVGKIPDDISRLSPELRYLSLFGNNFSGDIPASISRLSKLSSLQLHQTLLNGSFPQEIGYLNDLEELNLSFNKFTPSRLPPSFTQLKRLRKFYMTEANLIGEIPGNFSGMPAMEILDLSFNRLNGSIPRDLFLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019040`
TK1151 ID	TkA05G013050
OH-1004 ID	LXL04_019040
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019040

Location Chr04:22457673-22461177 (+)

Description Similar to HSL1: Receptor-like protein kinase HSL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28440`	Receptor-like protein kinase HSL1.	No verified direct reference in this release
`At5g65710`	Receptor-like serine/threonine-kinase acting on substrates that controls floral organ abscission.	No verified direct reference in this release
`At4g28490`	Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates that controls floral organ abscission.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019040 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

GO:0051707 response to other organism Biological Process

GO:0060866 leaf abscission Biological Process

GO:0140547 acquisition of seed longevity Biological Process

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G28440

ath:AT4G28490

ath:AT5G65710

gmx:732661

mtr:11439632

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.884

Rank 1 · LXL04_019040 · OH-1004

Endoplasmic reticulum0.077

Rank 2 · LXL04_019040 · OH-1004

Cytoplasm0.060

Rank 3 · LXL04_019040 · OH-1004

Nucleus0.037

Rank 4 · LXL04_019040 · OH-1004

Lysosome / Vacuole0.025

Rank 5 · LXL04_019040 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_229-65 aa

PF23598.2LRR_1473-219 aa

PF13855.13LRR_889-126 aa

PF12799.14LRR_491-132 aa

PF13855.13LRR_892-152 aa

PF13855.13LRR_8140-200 aa

PF23598.2LRR_14170-264 aa

PF13855.13LRR_8285-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019040	`PF08263.18`	LRRNT_2	29	65	8.9e-08	33.0
LXL04_019040	`PF23598.2`	LRR_14	73	219	2.8e-26	92.8
LXL04_019040	`PF13855.13`	LRR_8	89	126	6.4e-37	125.8
LXL04_019040	`PF12799.14`	LRR_4	91	132	6.6e-31	106.4
LXL04_019040	`PF13855.13`	LRR_8	92	152	6.4e-37	125.8
LXL04_019040	`PF13855.13`	LRR_8	140	200	6.4e-37	125.8
LXL04_019040	`PF23598.2`	LRR_14	170	264	2.8e-26	92.8
LXL04_019040	`PF13855.13`	LRR_8	285	344	6.4e-37	125.8
LXL04_019040	`PF00069.32`	Pkinase	689	970	1.5e-46	159.6
LXL04_019040	`PF07714.24`	PK_Tyr_Ser-Thr	690	970	5.8e-40	138.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGP2`	Arabidopsis thaliana	Receptor-like protein kinase HSL1	39.051%	Swiss-Prot	moderate database homology
`C0LGX3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase HSL2	38.732%	Swiss-Prot	moderate database homology
`P47735`	Arabidopsis thaliana	Receptor-like protein kinase 5	39.017%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card