LXL04_019038 | RubberDandelionOmics

Gene overview

LXL04_019038

Reference: OH-1004 Chr: Chr04 Coordinates: 22446524-22448200 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · LXL04_019038|LXL04_019038|OH1004|cDNA

ATGGAGTCCGATCCTACTCATCTTCTCACTTCAATTTTCTGGTTTGACAGCTCCTGTTTGCGGCAGTCGATCTTCAACCATAGGGCCAATCGAACAGCTTCAAGGTACTTCGATTATGATCCAGCTGCGATTCTGATTCCATCTTTGGTTGATGATGATGTATATGATGCGGAAAGCCAGAAAGCAGCTGAGCCTGAGCGAGGGCTCGAAGTGGAGGCTATGGAGCTAATGGTGGTGACATTGATTATTGGCTTCTTGTT...

CDS

Download CDS FASTA

573 bp · LXL04_019038|LXL04_019038|OH1004|CDS

ATGGAGTCCGATCCTACTCATCTTCTCACTTCAATTTTCTGGTTTGACAGCTCCTGTTTGCGGCAGTCGATCTTCAACCATAGGGCCAATCGAACAGCTTCAAGGTACTTCGATTATGATCCAGCTGCGATTCTGATTCCATCTTTGGTTGATGATGATGTATATGATGCGGAAAGCCAGAAAGCAGCTGAGCCTGAGCGAGGGCTCGAAGTGGAGGCTATGGAGCTAATGGTGGTGACATTGATTATTGGCTTCTTGTT...

Protein

Download Protein FASTA

190 aa · LXL04_019038|LXL04_019038|OH1004|PROTEIN

MESDPTHLLTSIFWFDSSCLRQSIFNHRANRTASRYFDYDPAAILIPSLVDDDVYDAESQKAAEPERGLEVEAMELMVVTLIIGFLLSLLFLAPRFIKSDQTKKVHSDTNNKIVKAYNKAEVSLHNTRTDCWIIIKEKVYDVTPYVEEHPGGDAILAHAGDDSTEGFFGPQHATRVFDMIDDFYIGELEK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019038`
TK1151 ID	TkA05G013000
OH-1004 ID	LXL04_019038
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 61.579 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019038

Location Chr04:22446524-22448200 (-)

Description Similar to CB5LP: Cytochrome B5-like protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60660`	Cytochrome B5-like protein.	No verified direct reference in this release
`At5g53560`	Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases, including fatty acid desaturases.	No verified direct reference in this release
`At1g26340`	Cytochrome b5 isoform A.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019038 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0010319 stromule Cellular Component

GO:0016020 membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0009055 electron transfer activity Molecular Function

KEGG gene cross-reference

ath:AT1G26340

ath:AT1G60660

ath:AT5G53560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.325

Rank 1 · LXL04_019038 · OH-1004

Nucleus0.202

Rank 2 · LXL04_019038 · OH-1004

Cytoplasm0.202

Rank 3 · LXL04_019038 · OH-1004

Mitochondrion0.147

Rank 4 · LXL04_019038 · OH-1004

Golgi apparatus0.128

Rank 5 · LXL04_019038 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00173.34Cyt-b5119-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019038	`PF00173.34`	Cyt-b5	119	188	4.6e-23	81.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22704`	Arabidopsis thaliana	Cytochrome B5-like protein	63.866%	Swiss-Prot	moderate database homology
`Q42342`	Arabidopsis thaliana	Cytochrome b5 isoform E	48.571%	Swiss-Prot	weak database homology
`Q9FDW8`	Arabidopsis thaliana	Cytochrome b5 isoform A	41.772%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card