LXL04_019019 | RubberDandelionOmics

Gene overview

LXL04_019019

Reference: OH-1004 Chr: Chr04 Coordinates: 22124960-22129813 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3210 bp · LXL04_019019|LXL04_019019|OH1004|cDNA

ATGGGTTGTGCTTTTTCAGTCGACTGTAGCTGTATCGGGGATATATGTTTACCTAGAGATCCTAAAGTAAAAGAAACCGACAATGTCGGTACATCTGAACTCGCCGTGTTCTCACCTAAATCTTCATTCAAGGAAGACGACGGAGACGCAAATCAGAATCCAGAAGCAGGTATAACAAGACTACGAAGAGTTTCATCACAGTTTTTACCACCAGATGGCTCTAGAATCGTCGTCATTCCAGCAGGAAACTACAGATTACA...

CDS

Download CDS FASTA

3210 bp · LXL04_019019|LXL04_019019|OH1004|CDS

ATGGGTTGTGCTTTTTCAGTCGACTGTAGCTGTATCGGGGATATATGTTTACCTAGAGATCCTAAAGTAAAAGAAACCGACAATGTCGGTACATCTGAACTCGCCGTGTTCTCACCTAAATCTTCATTCAAGGAAGACGACGGAGACGCAAATCAGAATCCAGAAGCAGGTATAACAAGACTACGAAGAGTTTCATCACAGTTTTTACCACCAGATGGCTCTAGAATCGTCGTCATTCCAGCAGGAAACTACAGATTACA...

Protein

Download Protein FASTA

1069 aa · LXL04_019019|LXL04_019019|OH1004|PROTEIN

MGCAFSVDCSCIGDICLPRDPKVKETDNVGTSELAVFSPKSSFKEDDGDANQNPEAGITRLRRVSSQFLPPDGSRIVVIPAGNYRLQYSYLSQRGYYPDALDKANQDSFCIHTPFGSNPNDHFFGVFDGHGEYGAQCSQFVKQKLCENLLRNSRFHVDPVDACHAAFLTTNSQLHADNNVDDSMSGTTAITVLVRGKTIYVANSGDSRAVIAEKRGTEIVAIDLSIDQTPYREDELERVKLCGARVLTLDQIEGLKNPDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019019`
TK1151 ID	TkA05G011720
OH-1004 ID	LXL04_019019
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019019

Location Chr04:22124960-22129813 (+)

Description Similar to At2g20050/At2g20040: Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9SL76`	Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein.	No verified direct reference in this release
`At3g06270`	Probable protein phosphatase 2C 35.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0646100`	Probable protein phosphatase 2C 65.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019019 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0036289 peptidyl-serine autophosphorylation Biological Process

GO:0046146 tetrahydrobiopterin metabolic process Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:1903829 positive regulation of protein localization Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G20050

ath:AT3G06270

dosa:Os07g0646100

hsa:5593

rno:25523

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.508

Rank 1 · LXL04_019019 · OH-1004

Cell membrane0.267

Rank 2 · LXL04_019019 · OH-1004

Nucleus0.261

Rank 3 · LXL04_019019 · OH-1004

Golgi apparatus0.100

Rank 4 · LXL04_019019 · OH-1004

Lysosome / Vacuole0.072

Rank 5 · LXL04_019019 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C110-356 aa

PF00027.36cNMP_binding492-582 aa

PF00027.36cNMP_binding618-715 aa

PF00069.32Pkinase774-1011 aa

PF07714.24PK_Tyr_Ser-Thr781-996 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019019	`PF00481.27`	PP2C	110	356	7.4e-37	128.1
LXL04_019019	`PF00027.36`	cNMP_binding	492	582	6.6e-27	94.0
LXL04_019019	`PF00027.36`	cNMP_binding	618	715	6.6e-27	94.0
LXL04_019019	`PF00069.32`	Pkinase	774	1011	2e-35	123.2
LXL04_019019	`PF07714.24`	PK_Tyr_Ser-Thr	781	996	3.9e-10	40.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SL76`	Arabidopsis thaliana	Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein	66.546%	Swiss-Prot	strong database homology
`Q7XJ53`	Arabidopsis thaliana	Probable protein phosphatase 2C 35	62.500%	Swiss-Prot	weak database homology
`Q8H2T0`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 65	50.160%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card