LXL04_018993 | RubberDandelionOmics

Gene overview

LXL04_018993

Reference: OH-1004 Chr: Chr04 Coordinates: 21213215-21216755 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3018 bp · LXL04_018993|LXL04_018993|OH1004|cDNA

ATGACGAAGATCTTTACCCCCAAATTCAATTTCTCATTCATCTTCCTCCTCATCTCAATCTCCATTTACCGCTTCAATAACCCCCCTCATTACCAAACCCTAATCCCCACACCATCActccaacaacaacaaccagTCGTTACTCGCAAGAACTACATTGTCAGATTCATCCAGTACAAGAAAGCGGAGGACCACAAGACGTATCTCGAGCAAAACGCCAATGAAATACCCAACGTCTCGTGTTCTTGGGAATGGATCGA...

CDS

Download CDS FASTA

3018 bp · LXL04_018993|LXL04_018993|OH1004|CDS

ATGACGAAGATCTTTACCCCCAAATTCAATTTCTCATTCATCTTCCTCCTCATCTCAATCTCCATTTACCGCTTCAATAACCCCCCTCATTACCAAACCCTAATCCCCACACCATCACTCCAACAACAACAACCAGTCGTTACTCGCAAGAACTACATTGTCAGATTCATCCAGTACAAGAAAGCGGAGGACCACAAGACGTATCTCGAGCAAAACGCCAATGAAATACCCAACGTCTCGTGTTCTTGGGAATGGATCGA...

Protein

Download Protein FASTA

1005 aa · LXL04_018993|LXL04_018993|OH1004|PROTEIN

MTKIFTPKFNFSFIFLLISISIYRFNNPPHYQTLIPTPSLQQQQPVVTRKNYIVRFIQYKKAEDHKTYLEQNANEIPNVSCSWEWIDRNNPASKFPTDFGVVAIDSDSVDSIVKKFETLDIVKDVRVDSSYQLRNLLGGRKTKRYERIGAFVDGRKRPGKIFTSMSFTDGEDFVAAAITANQTTDWNRQLLSQKPQVTSLFGADALWSKGYTGANVKMAIFDTGIRSDHPHFRNIKERTNWTNEKSLNDHIGHGTFVAGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018993`
TK1151 ID	TkA05G008350
OH-1004 ID	LXL04_018993
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 99.898 / OH-1004 97.512 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018993

Location Chr04:21213215-21216755 (+)

Description Similar to SBT6.1: Subtilisin-like protease SBT6.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19660`	Serine protease that catalyzes the first step (site-1 cleavage) in the proteolytic activation of various factors, prior to site-2 cleavage.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018993 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0006607 NLS-bearing protein import into nucleus Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0007040 lysosome organization Biological Process

GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process

GO:0008203 cholesterol metabolic process Biological Process

GO:0016485 protein processing Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0031293 membrane protein intracellular domain proteolysis Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

KEGG gene cross-reference

ath:AT5G19660

cge:100689417

hsa:8720

mmu:56453

rno:89842

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.427

Rank 1 · LXL04_018993 · OH-1004

Lysosome / Vacuole0.199

Rank 2 · LXL04_018993 · OH-1004

Endoplasmic reticulum0.176

Rank 3 · LXL04_018993 · OH-1004

Cytoplasm0.098

Rank 4 · LXL04_018993 · OH-1004

Cell membrane0.080

Rank 5 · LXL04_018993 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23001.2MBTP1_N48-127 aa

PF00082.28Peptidase_S8213-472 aa

PF23094.3MBTPS1_3rd493-621 aa

PF23090.2MBTPS1_4th622-884 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018993	`PF23001.2`	MBTP1_N	48	127	1.6e-17	64.3
LXL04_018993	`PF00082.28`	Peptidase_S8	213	472	7.3e-43	147.6
LXL04_018993	`PF23094.3`	MBTPS1_3rd	493	621	1.6e-52	177.4
LXL04_018993	`PF23090.2`	MBTPS1_4th	622	884	1.7e-133	445.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WUG6`	Arabidopsis thaliana	Subtilisin-like protease SBT6.1	65.959%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card