LXL04_018946 | RubberDandelionOmics

Gene overview

LXL04_018946

Reference: OH-1004 Chr: Chr04 Coordinates: 20316060-20316494 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

435 bp · LXL04_018946|LXL04_018946|OH1004|cDNA

ATGGCATCACCGCAGCCTGCCAATACGGGGTCTGATGGAGATCTCAAGTACGCAAACCTTGATGAGAGGAAAAGAAAGAGAATGCTATCAAACAGGGAATCTGCTCGTAGATCTCGTGCAAAGAAGCAACAACGTTTGGATGAATTGCTTGGTGAAATCAACCAACTACAGAACGATAACAACAAAATAATGCAGAAGATTGATGGGGCAACACAGGTGTTTGTTGGAGCTGCGTCTCAGAATAACGTTCTGAGAGCCCA...

CDS

Download CDS FASTA

435 bp · LXL04_018946|LXL04_018946|OH1004|CDS

ATGGCATCACCGCAGCCTGCCAATACGGGGTCTGATGGAGATCTCAAGTACGCAAACCTTGATGAGAGGAAAAGAAAGAGAATGCTATCAAACAGGGAATCTGCTCGTAGATCTCGTGCAAAGAAGCAACAACGTTTGGATGAATTGCTTGGTGAAATCAACCAACTACAGAACGATAACAACAAAATAATGCAGAAGATTGATGGGGCAACACAGGTGTTTGTTGGAGCTGCGTCTCAGAATAACGTTCTGAGAGCCCA...

Protein

Download Protein FASTA

144 aa · LXL04_018946|LXL04_018946|OH1004|PROTEIN

MASPQPANTGSDGDLKYANLDERKRKRMLSNRESARRSRAKKQQRLDELLGEINQLQNDNNKIMQKIDGATQVFVGAASQNNVLRAQLTELADRLHSLNSVLHIAQEVSGLSVDIPELPDTLLEPWKLPCPIQPITASFNMNMF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018946`
TK1151 ID	TkA05G005140
OH-1004 ID	LXL04_018946
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018946

Location Chr04:20316060-20316494 (+)

Description Similar to BZIP53: bZIP transcription factor 53

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62420`	May bind specific sequences in target-gene promoters and activate transcription.	A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.2004 · DOI: 10.1093/pcp/pch036 Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors.2006 · DOI: 10.1038/sj.emboj.7601206 A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.2009 · DOI: 10.1105/tpc.108.062968 Heterodimers of the Arabidopsis transcription factors bZIP1 and bZIP53 reprogram amino acid metabolism during low energy stress.2011 · DOI: 10.1105/tpc.110.075390 A novel method to identify the DNA motifs recognized by a defined transcription factor.2014 · DOI: 10.1007/s11103-014-0234-5
`At1g75390`	Transcription factor that binds to the DNA G-box motif 5'- CACGTG-3' of MAN7 promoter.	Arabidopsis thaliana bZIP44: a transcription factor affecting seed germination and expression of the mannanase-encoding gene AtMAN7.2013 · DOI: 10.1111/tpj.12162
`At2g18160`	Transcription factor that binds to specific DNA sequences in target gene promoters.	No verified direct reference in this release
`At4g34590`	Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters.	A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.2004 · DOI: 10.1093/pcp/pch036 The sucrose regulated transcription factor bZIP11 affects amino acid metabolism by regulating the expression of ASPARAGINE SYNTHETASE1 and PROLINE DEHYDROGENASE2.2008 · DOI: 10.1111/j.1365-313x.2007.03385.x The sucrose-regulated Arabidopsis transcription factor bZIP11 reprograms metabolism and regulates trehalose metabolism.2011 · DOI: 10.1111/j.1469-8137.2011.03735.x The Arabidopsis transcription factor bZIP11 activates auxin-mediated transcription by recruiting the histone acetylation machinery.2014 · DOI: 10.1038/ncomms4883

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018946 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006971 hypotonic response Biological Process

GO:0009267 cellular response to starvation Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009845 seed germination Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0080149 sucrose induced translational repression Biological Process

GO:2000693 positive regulation of seed maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G75390

ath:AT2G18160

ath:AT3G62420

ath:AT4G34590

zma:542394

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.956

Rank 1 · LXL04_018946 · OH-1004

Cytoplasm0.120

Rank 2 · LXL04_018946 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_018946 · OH-1004

Endoplasmic reticulum0.011

Rank 4 · LXL04_018946 · OH-1004

Plastid0.010

Rank 5 · LXL04_018946 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07716.21bZIP_220-68 aa

PF00170.27bZIP_123-69 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018946	`PF07716.21`	bZIP_2	20	68	9.7e-09	35.9
LXL04_018946	`PF00170.27`	bZIP_1	23	69	3.8e-10	40.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZP8`	Arabidopsis thaliana	bZIP transcription factor 53	56.061%	Swiss-Prot	strong database homology
`C0Z2L5`	Arabidopsis thaliana	bZIP transcription factor 44	42.143%	Swiss-Prot	moderate database homology
`Q9SI15`	Arabidopsis thaliana	bZIP transcription factor 2	50.000%	Swiss-Prot	moderate database homology
`O65683`	Arabidopsis thaliana	bZIP transcription factor 11	50.588%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card