LXL04_018903 | RubberDandelionOmics

Gene overview

LXL04_018903

Reference: OH-1004 Chr: Chr04 Coordinates: 19917284-19919205 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1521 bp · LXL04_018903|LXL04_018903|OH1004|cDNA

ATGGCCGCTTCTTCTTCTCCCACCTCCCTTCCCCAAATCCTCACCATTCTCCTCCTCCTAATCTCCGCCGCCGCCACAGCTTTCCCCACCAACAACCACCGCCTCCACCGCGTCGCCTCCCACAACTACAAAGACGCCCTCACTAAATCCCTCATTTTCTTCGAAGGCCAAAGGTCAGGCAAACTCCCCCCAAACCAGAGGATCACTTGGAGGAAAAACTCCGGTCTCTCAGACGGAGCAGCCGCAAAAGTGGATTTAGT...

CDS

Download CDS FASTA

1521 bp · LXL04_018903|LXL04_018903|OH1004|CDS

ATGGCCGCTTCTTCTTCTCCCACCTCCCTTCCCCAAATCCTCACCATTCTCCTCCTCCTAATCTCCGCCGCCGCCACAGCTTTCCCCACCAACAACCACCGCCTCCACCGCGTCGCCTCCCACAACTACAAAGACGCCCTCACTAAATCCCTCATTTTCTTCGAAGGCCAAAGGTCAGGCAAACTCCCCCCAAACCAGAGGATCACTTGGAGGAAAAACTCCGGTCTCTCAGACGGAGCAGCCGCAAAAGTGGATTTAGT...

Protein

Download Protein FASTA

506 aa · LXL04_018903|LXL04_018903|OH1004|PROTEIN

MAASSSPTSLPQILTILLLLISAAATAFPTNNHRLHRVASHNYKDALTKSLIFFEGQRSGKLPPNQRITWRKNSGLSDGAAAKVDLVGGYYDAGDNVKFGFPMAFTTTMLSWSVLEFGGMMKGELGNAKEAIRWATDYLLKATAEPDVIYVQVGDATKDHACWERPEDMDTPRTVIKIDRNTPGTEVAAETAAALASASLVFRKSDRTYSKLLLKRAISVFEFADKYRGSYSSGLKKFVCPYYCSYSGFQDELLWGAAWL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018903`
TK1151 ID	TkA05G003830
OH-1004 ID	LXL04_018903
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018903

Location Chr04:19917284-19919205 (+)

Description Similar to At4g02290: Endoglucanase 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02290`	Endoglucanase 17.	No verified direct reference in this release
`At1g02800`	Endoglucanase 1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0312800`	Endoglucanase 3.	No verified direct reference in this release
`Os06g0256900`	Endoglucanase 17.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018903 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007389 pattern specification process Biological Process

GO:0009624 response to nematode Biological Process

GO:0009835 fruit ripening Biological Process

GO:0030245 cellulose catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0008810 cellulase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02800

ath:AT4G02290

dosa:Os01g0312800

dosa:Os06g0256900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.540

Rank 1 · LXL04_018903 · OH-1004

Cell membrane0.233

Rank 2 · LXL04_018903 · OH-1004

Endoplasmic reticulum0.087

Rank 3 · LXL04_018903 · OH-1004

Cytoplasm0.087

Rank 4 · LXL04_018903 · OH-1004

Lysosome / Vacuole0.076

Rank 5 · LXL04_018903 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00759.26Glyco_hydro_943-496 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018903	`PF00759.26`	Glyco_hydro_9	43	496	6.4e-162	540.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81416`	Arabidopsis thaliana	Endoglucanase 17	78.678%	Swiss-Prot	strong database homology
`Q9SRX3`	Arabidopsis thaliana	Endoglucanase 1	72.222%	Swiss-Prot	strong database homology
`Q8LQ92`	Oryza sativa subsp. japonica	Endoglucanase 3	70.040%	Swiss-Prot	strong database homology
`Q652F9`	Oryza sativa subsp. japonica	Endoglucanase 17	61.111%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card