LXL04_018878 | RubberDandelionOmics

Gene overview

LXL04_018878

Reference: OH-1004 Chr: Chr04 Coordinates: 19519512-19520607 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

906 bp · LXL04_018878|LXL04_018878|OH1004|cDNA

ATGGCAAAGCTACCAGTTGCTGGTAACACTACCACCTCCGACCACCTTCAGACTTGGATCTTGAGAGTTTACATCCACTGCGAAGGATGCAAGAAGAAAGTCTTCAAAGTCCTTCAGAGTATCGATGGTGATAATCCTCTGCTTCTTAATTCATCTTCATTTCTCAGAGTTTATAAGACGGAAATCGACTCGCTGCAGCGCAAGGCTATAGTTACTGGATCAGTCGACGGCAATACTCTCGTCCAGAAGCTTCTCAGAGC...

CDS

Download CDS FASTA

906 bp · LXL04_018878|LXL04_018878|OH1004|CDS

ATGGCAAAGCTACCAGTTGCTGGTAACACTACCACCTCCGACCACCTTCAGACTTGGATCTTGAGAGTTTACATCCACTGCGAAGGATGCAAGAAGAAAGTCTTCAAAGTCCTTCAGAGTATCGATGGTGATAATCCTCTGCTTCTTAATTCATCTTCATTTCTCAGAGTTTATAAGACGGAAATCGACTCGCTGCAGCGCAAGGCTATAGTTACTGGATCAGTCGACGGCAATACTCTCGTCCAGAAGCTTCTCAGAGC...

Protein

Download Protein FASTA

301 aa · LXL04_018878|LXL04_018878|OH1004|PROTEIN

MAKLPVAGNTTTSDHLQTWILRVYIHCEGCKKKVFKVLQSIDGDNPLLLNSSSFLRVYKTEIDSLQRKAIVTGSVDGNTLVQKLLRAGKHAEVLPESFKPKAAADSAPGKSKKKKKKQKDAETTDADSLHVDEEKQESEVATTEGIDSAKEYESAEAAIAAVDGNGGGGGGGKKKKKKNKGDKKDNNAPADTESVPATADNLQASMEQLDLSRPGPPGPDMVYATPYNLPPNYYPAPAYGVSYNTSYPSAESSYYTPPVY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018878`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018878

Location Chr04:19519512-19520607 (+)

Description Similar to HIPP36: Heavy metal-associated isoprenylated plant protein 36

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27690`	Heavy-metal-binding protein.	No verified direct reference in this release
`At3g06130`	Heavy-metal-binding protein.	No verified direct reference in this release
`At1g23000`	Heavy-metal-binding protein.	No verified direct reference in this release
`At5g19090`	Heavy-metal-binding protein.	No verified direct reference in this release
`At3g05220`	Heavy-metal-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018878 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G23000

ath:AT3G05220

ath:AT3G06130

ath:AT5G19090

ath:AT5G27690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.506

Rank 1 · LXL04_018878 · OH-1004

Cytoplasm0.329

Rank 2 · LXL04_018878 · OH-1004

Nucleus0.327

Rank 3 · LXL04_018878 · OH-1004

Endoplasmic reticulum0.064

Rank 4 · LXL04_018878 · OH-1004

Golgi apparatus0.029

Rank 5 · LXL04_018878 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84J88`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 36	41.121%	Swiss-Prot	weak database homology
`Q9M8K5`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 32	47.436%	Swiss-Prot	weak database homology
`A2RVM8`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 37	47.436%	Swiss-Prot	weak database homology
`F4JZL7`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 33	44.872%	Swiss-Prot	weak database homology
`Q0WV37`	Arabidopsis thaliana	Heavy metal-associated isoprenylated plant protein 34	45.570%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card