LXL04_018867 | RubberDandelionOmics

Gene overview

LXL04_018867

Reference: OH-1004 Chr: Chr04 Coordinates: 19376917-19377216 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

300 bp · LXL04_018867|LXL04_018867|OH1004|cDNA

ATGGATAGAGTGAAAGATTTGGCATCCAAGAAGGCTGCAGTTATCTTCACGAAAAGCTCGTGTTGTATGTGTCATAGTATCAAAGCGCTATTTTATGATCTTGGTGCAAGTCCTGCAATCCATGAAGTTGATCATGATCCAGATATGGAGCGGGCGTTAAGGCGGTTGGGTTGTAATCCGGCGGTCCCTGCAGTGTTTGTGGGCGGTAAATATATAGGTTCAGCTAGAGATATTATTTCTCTTCATGTTGATGGGTCATT...

CDS

Download CDS FASTA

300 bp · LXL04_018867|LXL04_018867|OH1004|CDS

ATGGATAGAGTGAAAGATTTGGCATCCAAGAAGGCTGCAGTTATCTTCACGAAAAGCTCGTGTTGTATGTGTCATAGTATCAAAGCGCTATTTTATGATCTTGGTGCAAGTCCTGCAATCCATGAAGTTGATCATGATCCAGATATGGAGCGGGCGTTAAGGCGGTTGGGTTGTAATCCGGCGGTCCCTGCAGTGTTTGTGGGCGGTAAATATATAGGTTCAGCTAGAGATATTATTTCTCTTCATGTTGATGGGTCATT...

Protein

Download Protein FASTA

99 aa · LXL04_018867|LXL04_018867|OH1004|PROTEIN

MDRVKDLASKKAAVIFTKSSCCMCHSIKALFYDLGASPAIHEVDHDPDMERALRRLGCNPAVPAVFVGGKYIGSARDIISLHVDGSLKQKLIDARAIWF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018867`
TK1151 ID	TkA08G087220
OH-1004 ID	LXL04_018867
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 57.988 / OH-1004 98.990 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018867

Location Chr04:19376917-19377216 (-)

Description Similar to GRXC11: Glutaredoxin-C11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62950`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release
`At2g47870`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release
`At3g21460`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release
`At2g47880`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release
`At3g62960`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018867 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0010167 response to nitrate Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0046872 metal ion binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT2G47870

ath:AT2G47880

ath:AT3G21460

ath:AT3G62950

ath:AT3G62960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.600

Rank 1 · LXL04_018867 · OH-1004

Nucleus0.357

Rank 2 · LXL04_018867 · OH-1004

Cell membrane0.163

Rank 3 · LXL04_018867 · OH-1004

Endoplasmic reticulum0.052

Rank 4 · LXL04_018867 · OH-1004

Lysosome / Vacuole0.047

Rank 5 · LXL04_018867 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00462.31Glutaredoxin14-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018867	`PF00462.31`	Glutaredoxin	14	72	1.2e-15	58.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYC6`	Arabidopsis thaliana	Glutaredoxin-C11	78.641%	Swiss-Prot	strong database homology
`O82254`	Arabidopsis thaliana	Putative glutaredoxin-C12	75.728%	Swiss-Prot	strong database homology
`Q9LIF1`	Arabidopsis thaliana	Monothiol glutaredoxin-S10	57.843%	Swiss-Prot	strong database homology
`O82255`	Arabidopsis thaliana	Glutaredoxin-C13	51.961%	Swiss-Prot	strong database homology
`Q9LYC5`	Arabidopsis thaliana	Glutaredoxin-C14	57.778%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card