LXL04_018848 | RubberDandelionOmics

Gene overview

LXL04_018848

Reference: OH-1004 Chr: Chr04 Coordinates: 19118122-19127464 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1743 bp · LXL04_018848|LXL04_018848|OH1004|cDNA

ATGGAGCTTCGGGTGCTGTGTTCATCGAGTTATGGTGACAGTGGCCATGGAAGATCCGGTGGTGGCTGTACAGTCGCCTGGAGGATCGAAGAAGACCATCGGGGAAGAAGGAATCGCCTCGGGGATGGCGAAACTGTTGAGTACGTTGTCGAGAACGGATCCGACGGACGAACCAAAGCTGCTCACGTAACTGGTCCTGAAGAGGGTCCTGTACAGGGAAGCAGTCGTGGAGCAGATGACGGAGGAGGAGCTGGATCGTC...

CDS

Download CDS FASTA

1743 bp · LXL04_018848|LXL04_018848|OH1004|CDS

ATGGAGCTTCGGGTGCTGTGTTCATCGAGTTATGGTGACAGTGGCCATGGAAGATCCGGTGGTGGCTGTACAGTCGCCTGGAGGATCGAAGAAGACCATCGGGGAAGAAGGAATCGCCTCGGGGATGGCGAAACTGTTGAGTACGTTGTCGAGAACGGATCCGACGGACGAACCAAAGCTGCTCACGTAACTGGTCCTGAAGAGGGTCCTGTACAGGGAAGCAGTCGTGGAGCAGATGACGGAGGAGGAGCTGGATCGTC...

Protein

Download Protein FASTA

580 aa · LXL04_018848|LXL04_018848|OH1004|PROTEIN

MELRVLCSSSYGDSGHGRSGGGCTVAWRIEEDHRGRRNRLGDGETVEYVVENGSDGRTKAAHVTGPEEGPVQGSSRGADDGGGAGSSPRSSGRRIGRDDEIGRDEGKMGKAKEGLIAMEDQADLLTATGGGSGFTASATIDDSVCDLIEKIATRQLNSSKLMDSTMNPFYTAVKKEYPSASSSPSRTTTMPQPMEGLHVAGPPPFLTKIYDMVDDQSMDHIVSWSRGGKSFVVWDPHAFSTNLLPRFFKHNNFSSFVRQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018848`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018848

Location Chr04:19118122-19127464 (+)

Description Similar to HSFA6b: Heat stress transcription factor A-6b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22830`	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0178600`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release
`Os03g0795900`	Transcriptional activator expressed upon environmental stress that specifically binds DNA of heat shock promoter elements (HSE).	Expression of rice heat stress transcription factor OsHsfA2e enhances tolerance to environmental stresses in transgenic Arabidopsis.2008 · DOI: 10.1007/s00425-007-0670-4
`Os10g0419300`	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE).	Isolation and characterization of a cDNA encoding two novel heat-shock factor OsHSF6 and OsHSF12 in Oryza sativa L.2005 · DOI: 10.5483/bmbrep.2005.38.5.602
`Os03g0161900`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018848 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT3G22830

dosa:Os03g0161900

dosa:Os03g0795900

dosa:Os07g0178600

dosa:Os10g0419300

osa:4331707

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.933

Rank 1 · LXL04_018848 · OH-1004

Cytoplasm0.113

Rank 2 · LXL04_018848 · OH-1004

Cell membrane0.038

Rank 3 · LXL04_018848 · OH-1004

Endoplasmic reticulum0.024

Rank 4 · LXL04_018848 · OH-1004

Plastid0.016

Rank 5 · LXL04_018848 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00447.24HSF_DNA-bind205-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018848	`PF00447.24`	HSF_DNA-bind	205	294	3.5e-30	105.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUH8`	Arabidopsis thaliana	Heat stress transcription factor A-6b	46.917%	Swiss-Prot	moderate database homology
`Q6VBB2`	Oryza sativa subsp. japonica	Heat stress transcription factor A-2b	55.627%	Swiss-Prot	weak database homology
`Q6F388`	Oryza sativa subsp. japonica	Heat stress transcription factor A-2e	51.961%	Swiss-Prot	weak database homology
`Q338B0`	Oryza sativa subsp. japonica	Heat stress transcription factor A-2c	51.506%	Swiss-Prot	moderate database homology
`Q8H7Y6`	Oryza sativa subsp. japonica	Heat stress transcription factor A-2d	50.467%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card