LXL04_018843 | RubberDandelionOmics

Gene overview

LXL04_018843

Reference: OH-1004 Chr: Chr04 Coordinates: 19082342-19083403 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1062 bp · LXL04_018843|LXL04_018843|OH1004|cDNA

ATGGTCAATCAGAGAATCTCTTCTCTCTCTTCCACCATCGGCCTCCTGTCTATCTTCTTAATCCTCCTAAcaaccgccaccaccaccaccatggCTGCCGCCACCAACATCCGCCTTAGCCTCATAAAAAAACCCTCAAAAGCTCTACCCGTTTTCCGTGAAGCCCCAGCGTTTCGCAACGGCGACACCTGTACCAAAAACATCGTACACGTCGCCATGACTCTCGACTCCAACTACCTTCGTGGGACCATGGCGGCGGT...

CDS

Download CDS FASTA

1062 bp · LXL04_018843|LXL04_018843|OH1004|CDS

ATGGTCAATCAGAGAATCTCTTCTCTCTCTTCCACCATCGGCCTCCTGTCTATCTTCTTAATCCTCCTAACAACCGCCACCACCACCACCATGGCTGCCGCCACCAACATCCGCCTTAGCCTCATAAAAAAACCCTCAAAAGCTCTACCCGTTTTCCGTGAAGCCCCAGCGTTTCGCAACGGCGACACCTGTACCAAAAACATCGTACACGTCGCCATGACTCTCGACTCCAACTACCTTCGTGGGACCATGGCGGCGGT...

Protein

Download Protein FASTA

353 aa · LXL04_018843|LXL04_018843|OH1004|PROTEIN

MVNQRISSLSSTIGLLSIFLILLTTATTTTMAAATNIRLSLIKKPSKALPVFREAPAFRNGDTCTKNIVHVAMTLDSNYLRGTMAAVLSILQHSFCPENVYFHFLWSHNDEEIYKNIKTTFPYLKFKVYKFDSNRVKGKISKSVRQALDQPLNYARVYLADILPKNVKRVIYLDSDIIMVDDVEKLWRVELEGKVIGAPEYCEANFTRYFTKNFWMDRGLAKTFTGRKPCYFNTGVMVVDVLKWRKGGFSYRVEEWMVVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018843`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018843

Location Chr04:19082342-19083403 (-)

Description Similar to GATL4: Probable galacturonosyltransferase-like 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06260`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At4g02130`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At3g62660`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At1g13250`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At1g02720`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018843 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0045489 pectin biosynthetic process Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0048363 mucilage pectin metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0071668 plant-type cell wall assembly Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0047262 polygalacturonate 4-alpha-galacturonosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02720

ath:AT1G13250

ath:AT3G06260

ath:AT3G62660

ath:AT4G02130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.765

Rank 1 · LXL04_018843 · OH-1004

Extracellular0.084

Rank 2 · LXL04_018843 · OH-1004

Endoplasmic reticulum0.078

Rank 3 · LXL04_018843 · OH-1004

Cell membrane0.070

Rank 4 · LXL04_018843 · OH-1004

Cytoplasm0.055

Rank 5 · LXL04_018843 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01501.27Glyco_transf_870-325 aa

PF18404.8Glyco_transf_2487-246 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018843	`PF01501.27`	Glyco_transf_8	70	325	3.9e-56	191.2
LXL04_018843	`PF18404.8`	Glyco_transf_24	87	246	5.7e-09	36.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8J2`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 4	70.270%	Swiss-Prot	strong database homology
`O04253`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 6	57.895%	Swiss-Prot	strong database homology
`Q8VYF4`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 7	58.286%	Swiss-Prot	strong database homology
`Q0V7R1`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 3	60.559%	Swiss-Prot	strong database homology
`Q9FWY9`	Arabidopsis thaliana	Probable galacturonosyltransferase-like 5	62.295%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card