Gene Card
Gene overview
cDNA / CDS / Protein Sequences
423 bp · LXL04_018833|LXL04_018833|OH1004|cDNA
ATGGTGTCGCCGTCGAATGAGCAGATAAATCGGGAAGAGATACCGACAGTTAAAGACCTGATGCATAAAACGAAAATAATTCAGTTCTTTGGAAGAACTACTCCGATTATACTTCAGAAGGACAATGGTCCATGTCCTCTTCTGGCTATTTCGTACGTTTCGTACAAAGATGAAGGGTATGTTGAAAATCAACAACAGAACATATCCGATGCCATTGATTTACTCCCTCAACTTACAACTGGCATTGATGTAAACATTAA...
423 bp · LXL04_018833|LXL04_018833|OH1004|CDS
ATGGTGTCGCCGTCGAATGAGCAGATAAATCGGGAAGAGATACCGACAGTTAAAGACCTGATGCATAAAACGAAAATAATTCAGTTCTTTGGAAGAACTACTCCGATTATACTTCAGAAGGACAATGGTCCATGTCCTCTTCTGGCTATTTCGTACGTTTCGTACAAAGATGAAGGGTATGTTGAAAATCAACAACAGAACATATCCGATGCCATTGATTTACTCCCTCAACTTACAACTGGCATTGATGTAAACATTAA...
Protein
Download Protein FASTA140 aa · LXL04_018833|LXL04_018833|OH1004|PROTEIN
MVSPSNEQINREEIPTVKDLMHKTKIIQFFGRTTPIILQKDNGPCPLLAISYVSYKDEGYVENQQQNISDAIDLLPQLTTGIDVNIKFTRINDFELTRECAIFDLLDIPLYHGWIVDPHVQHSSIHLNIHIHYEDVEDKV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_018833 |
|---|---|
| TK1151 ID | TkA01G012150 |
| OH-1004 ID | LXL04_018833 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 57.500 |
| Protein coverage (%) | TK1151 23.810 / OH-1004 88.571Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_018833 |
|---|---|
| Location | Chr04:18926548-18927192 (-) |
| Description | Similar to Mindy1: Ubiquitin carboxyl-terminal hydrolase MINDY-1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006508 proteolysis Biological Process GO:0071108 protein K48-linked deubiquitination Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0016604 nuclear body Cellular Component GO:0071944 cell periphery Cellular Component GO:0004843 cysteine-type deubiquitinase activity Molecular Function GO:0016807 cysteine-type carboxypeptidase activity Molecular Function GO:0036435 K48-linked polyubiquitin modification-dependent protein binding Molecular Function GO:1990380 K48-linked deubiquitinase activity Molecular Function |
| KEGG gene cross-reference | bta:505719 hsa:55793 mmu:75007 pon:100174611 rno:310665 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04424.20MINDY_DUB22-51 aaPF04424.20MINDY_DUB56-139 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_018833 | PF04424.20 | MINDY_DUB | 22 | 51 | 2.2e-33 | 116.4 |
| LXL04_018833 | PF04424.20 | MINDY_DUB | 56 | 139 | 2.2e-33 | 116.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.