LXL04_018812 | RubberDandelionOmics

Gene overview

LXL04_018812

Reference: OH-1004 Chr: Chr04 Coordinates: 18531244-18532751 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · LXL04_018812|LXL04_018812|OH1004|cDNA

ATGACAACAATTCGAAGATTCTGCTGCGATGATCTTCTACGATTCTCTTCTGTAAACCTCGACCATCTCACAGAAACTTTCAATATGTCATTCTATATGACCTACTTGGCACGCTGGCCCGATTATTTCCATGTCGCCGAAGCTCCAGGAAACAGAGTCATGGGATACATTATGGGTAAAGTTGAAGGGCAAGGTGAGTCATGGCATGGACACGTAACAGCAGTTACAGTAGCTCCAGAATTTCGCAGACAACAGTTGGC...

CDS

Download CDS FASTA

525 bp · LXL04_018812|LXL04_018812|OH1004|CDS

ATGACAACAATTCGAAGATTCTGCTGCGATGATCTTCTACGATTCTCTTCTGTAAACCTCGACCATCTCACAGAAACTTTCAATATGTCATTCTATATGACCTACTTGGCACGCTGGCCCGATTATTTCCATGTCGCCGAAGCTCCAGGAAACAGAGTCATGGGATACATTATGGGTAAAGTTGAAGGGCAAGGTGAGTCATGGCATGGACACGTAACAGCAGTTACAGTAGCTCCAGAATTTCGCAGACAACAGTTGGC...

Protein

Download Protein FASTA

174 aa · LXL04_018812|LXL04_018812|OH1004|PROTEIN

MTTIRRFCCDDLLRFSSVNLDHLTETFNMSFYMTYLARWPDYFHVAEAPGNRVMGYIMGKVEGQGESWHGHVTAVTVAPEFRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIKMYEKLEYVIYRRVLRYYSGEEDGLDMRKALSRDVERKSIIPLKRPVTPDELEYD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018812`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018812

Location Chr04:18531244-18532751 (+)

Description Similar to NAA20: N-terminal acetyltransferase B complex catalytic subunit NAA20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03150`	Catalytic subunit of the NatB N-alpha-acetyltransferase complex.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018812 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006474 N-terminal protein amino acid acetylation Biological Process

GO:0017190 N-terminal peptidyl-aspartic acid acetylation Biological Process

GO:0017192 N-terminal peptidyl-glutamine acetylation Biological Process

GO:0017196 N-terminal peptidyl-methionine acetylation Biological Process

GO:0018002 N-terminal peptidyl-glutamic acid acetylation Biological Process

GO:0032956 regulation of actin cytoskeleton organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0031416 NatB complex Cellular Component

GO:0004596 protein-N-terminal amino-acid acetyltransferase activity Molecular Function

GO:0120518 protein N-terminal-methionine acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G03150

ddi:DDB_G0276345

hsa:51126

mmu:67877

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.607

Rank 1 · LXL04_018812 · OH-1004

Nucleus0.474

Rank 2 · LXL04_018812 · OH-1004

Cell membrane0.119

Rank 3 · LXL04_018812 · OH-1004

Mitochondrion0.060

Rank 4 · LXL04_018812 · OH-1004

Lysosome / Vacuole0.047

Rank 5 · LXL04_018812 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00583.32Acetyltransf_127-126 aa

PF13508.14Acetyltransf_741-128 aa

PF13673.14Acetyltransf_1041-128 aa

PF08445.17FR4770-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018812	`PF00583.32`	Acetyltransf_1	27	126	9.3e-17	62.1
LXL04_018812	`PF13508.14`	Acetyltransf_7	41	128	1.9e-10	41.7
LXL04_018812	`PF13673.14`	Acetyltransf_10	41	128	5.2e-08	33.7
LXL04_018812	`PF08445.17`	FR47	70	130	8.8e-07	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LGI8`	Arabidopsis thaliana	N-terminal acetyltransferase B complex catalytic subunit NAA20	93.678%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card