LXL04_018786 | RubberDandelionOmics

Gene overview

LXL04_018786

Reference: OH-1004 Chr: Chr04 Coordinates: 18232090-18233611 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

732 bp · LXL04_018786|LXL04_018786|OH1004|cDNA

ATGTTGAACCGAATGTTCGGGAAAACCGACCCGGAGTCGGGGTCGAGTGAACCGTTGTATCCGACGATGGTTGAATCACCGGATCTCCGGTGGTCTTTCATCCGCAAAATATACTCGATTGTCGCCATACAGTTACTCCTCACCGCCGTTGTCGGTGCTATTGTGGTCTCTTATCATCCAATCATCACTTTCCTCACGACAACGAGAGGCGGATTCGCCTGTTACATTCTCATCATAGTTACTCCTTTCATCATGCTTTG...

CDS

Download CDS FASTA

732 bp · LXL04_018786|LXL04_018786|OH1004|CDS

ATGTTGAACCGAATGTTCGGGAAAACCGACCCGGAGTCGGGGTCGAGTGAACCGTTGTATCCGACGATGGTTGAATCACCGGATCTCCGGTGGTCTTTCATCCGCAAAATATACTCGATTGTCGCCATACAGTTACTCCTCACCGCCGTTGTCGGTGCTATTGTGGTCTCTTATCATCCAATCATCACTTTCCTCACGACAACGAGAGGCGGATTCGCCTGTTACATTCTCATCATAGTTACTCCTTTCATCATGCTTTG...

Protein

Download Protein FASTA

243 aa · LXL04_018786|LXL04_018786|OH1004|PROTEIN

MLNRMFGKTDPESGSSEPLYPTMVESPDLRWSFIRKIYSIVAIQLLLTAVVGAIVVSYHPIITFLTTTRGGFACYILIIVTPFIMLCPLSCYYQRHPVNYILLGIFTIALAFGVGLSCAFTSGKVILEAVILTAVVVVSLTLFTFWAAKRGSDFNFLGPFLFGALMVLIVFSIIQIFFPMGKISVMIYAGLSAIIFCGYIIYDTDNLIKRYSYDEYIWAAIALYLDVINLFLSLLTILRGVDR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018786`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018786

Location Chr04:18232090-18233611 (+)

Description Similar to LFG2: Protein LIFEGUARD 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63310`	Regulates the brassinosteroid (BR) signaling pathway that mediates cell elongation and organ morphogenesis.	LIFEGUARD proteins support plant colonization by biotrophic powdery mildew fungi.2013 · DOI: 10.1093/jxb/ert217
`At1g03070`	Protein LIFEGUARD 4.	No verified direct reference in this release
`At4g02690`	Protein LIFEGUARD 3.	No verified direct reference in this release
`At4g14730`	(Microbial infection) Facilitates the development of the powdery mildew fungus E.cruciferarum.	LIFEGUARD proteins support plant colonization by biotrophic powdery mildew fungi.2013 · DOI: 10.1093/jxb/ert217
`At4g15470`	BI1-like protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018786 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0034620 cellular response to unfolded protein Biological Process

GO:1905421 regulation of plant organ morphogenesis Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0005262 calcium channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G03070

ath:AT3G63310

ath:AT4G02690

ath:AT4G14730

ath:AT4G15470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.354

Rank 1 · LXL04_018786 · OH-1004

Cytoplasm0.270

Rank 2 · LXL04_018786 · OH-1004

Golgi apparatus0.238

Rank 3 · LXL04_018786 · OH-1004

Cell membrane0.179

Rank 4 · LXL04_018786 · OH-1004

Endoplasmic reticulum0.170

Rank 5 · LXL04_018786 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01027.27Bax1-I30-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018786	`PF01027.27`	Bax1-I	30	240	1.3e-50	172.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1V9`	Arabidopsis thaliana	Protein LIFEGUARD 2	74.894%	Swiss-Prot	strong database homology
`Q9SA63`	Arabidopsis thaliana	Protein LIFEGUARD 4	68.313%	Swiss-Prot	strong database homology
`Q9ZQX7`	Arabidopsis thaliana	Protein LIFEGUARD 3	67.623%	Swiss-Prot	strong database homology
`F4JIE8`	Arabidopsis thaliana	Protein LIFEGUARD 1	54.741%	Swiss-Prot	strong database homology
`Q94A20`	Arabidopsis thaliana	BI1-like protein	53.469%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card