LXL04_018766 | RubberDandelionOmics

Gene overview

LXL04_018766

Reference: OH-1004 Chr: Chr04 Coordinates: 17928882-17930059 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1008 bp · LXL04_018766|LXL04_018766|OH1004|cDNA

ATGGAAGAAGTCGAAGCTGCTAATAGAACTGCCGTTGAAAGCTGCCATAAAATCCTCACGCTTTTAGCTCAACCACAAGATCAAATTCAGTACAAAAACTTAACCGTACAAACAGGGGATGCAGTCGTTAGATTCAACAAGGTTGTATCTCTACTCAACAATGGTTTAGGTCACGCTAGGGTTAGAATGGTCAAGAAAATTGCAACCCCTGTTCCCCAAAACATACTCCAAGACACCCCCACCCACCACCACCCACCAAA...

CDS

Download CDS FASTA

1008 bp · LXL04_018766|LXL04_018766|OH1004|CDS

ATGGAAGAAGTCGAAGCTGCTAATAGAACTGCCGTTGAAAGCTGCCATAAAATCCTCACGCTTTTAGCTCAACCACAAGATCAAATTCAGTACAAAAACTTAACCGTACAAACAGGGGATGCAGTCGTTAGATTCAACAAGGTTGTATCTCTACTCAACAATGGTTTAGGTCACGCTAGGGTTAGAATGGTCAAGAAAATTGCAACCCCTGTTCCCCAAAACATACTCCAAGACACCCCCACCCACCACCACCCACCAAA...

Protein

Download Protein FASTA

335 aa · LXL04_018766|LXL04_018766|OH1004|PROTEIN

MEEVEAANRTAVESCHKILTLLAQPQDQIQYKNLTVQTGDAVVRFNKVVSLLNNGLGHARVRMVKKIATPVPQNILQDTPTHHHPPKPLQLLLDSHPIQEIGANAVKNNTLSLSNHHPSLELNSNGKCSIQITQNPPHHSPNYHFLQQQKLKQQAEMMYRRSNSGISLNFDSSTCTPTMSSNRSFMSSLSIEGSVANLDGSSFRLIGSTRSADQGSYQHKRRCSGRGDDGSVKCGSSGRCHCSKKRKHRIKRSIKVPAIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018766`
TK1151 ID	TkA08G082220
OH-1004 ID	LXL04_018766
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018766

Location Chr04:17928882-17930059 (-)

Description Similar to WRKY21: Probable WRKY transcription factor 21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30590`	Transcription factor.	No verified direct reference in this release
`At3g04670`	Transcription factor.	No verified direct reference in this release
`At5g28650`	Transcription factor.	No verified direct reference in this release
`At4g31550`	Transcription factor.	Transcription factors WRKY70 and WRKY11 served as regulators in rhizobacterium Bacillus cereus AR156-induced systemic resistance to Pseudomonas syringae pv. tomato DC3000 in Arabidopsis.2016 · DOI: 10.1093/jxb/erv445

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018766 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT2G30590

ath:AT3G04670

ath:AT4G31550

ath:AT5G28650

zma:732738

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965

Rank 1 · LXL04_018766 · OH-1004

Cytoplasm0.107

Rank 2 · LXL04_018766 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_018766 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_018766 · OH-1004

Plastid0.009

Rank 5 · LXL04_018766 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10533.15Plant_zn_clust220-265 aa

PF03106.22WRKY269-326 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018766	`PF10533.15`	Plant_zn_clust	220	265	8.5e-18	64.9
LXL04_018766	`PF03106.22`	WRKY	269	326	5e-27	94.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04336`	Arabidopsis thaliana	Probable WRKY transcription factor 21	51.444%	Swiss-Prot	strong database homology
`Q9SR07`	Arabidopsis thaliana	Probable WRKY transcription factor 39	53.314%	Swiss-Prot	strong database homology
`Q93WU6`	Arabidopsis thaliana	Probable WRKY transcription factor 74	48.596%	Swiss-Prot	moderate database homology
`Q9SV15`	Arabidopsis thaliana	Probable WRKY transcription factor 11	36.012%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card