LXL04_018678 | RubberDandelionOmics

Gene overview

LXL04_018678

Reference: OH-1004 Chr: Chr04 Coordinates: 16556968-16562416 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2775 bp · LXL04_018678|LXL04_018678|OH1004|cDNA

ATGCAACTATATCTTAAATTAACTTGTGTCTTGTCTCCACTTACTAAAACTCTGAATCATATGGATCTCCATTGGTGCTTCTTCACTATTCTCTTGTTTTTTAGCTACCCCAACCTCATTTCATGTGATCAAGAAGGTTTTTGGAGTTTGTCATGTGGAAGTGCTACAAATTTCATTGACTCATCCAACATTTCATGGGTATCAGACTATAACTATATCACAAAAGGGAACACTACAATTGTCGATTCCAATGAGTCGAT...

CDS

Download CDS FASTA

2775 bp · LXL04_018678|LXL04_018678|OH1004|CDS

ATGCAACTATATCTTAAATTAACTTGTGTCTTGTCTCCACTTACTAAAACTCTGAATCATATGGATCTCCATTGGTGCTTCTTCACTATTCTCTTGTTTTTTAGCTACCCCAACCTCATTTCATGTGATCAAGAAGGTTTTTGGAGTTTGTCATGTGGAAGTGCTACAAATTTCATTGACTCATCCAACATTTCATGGGTATCAGACTATAACTATATCACAAAAGGGAACACTACAATTGTCGATTCCAATGAGTCGAT...

Protein

Download Protein FASTA

924 aa · LXL04_018678|LXL04_018678|OH1004|PROTEIN

MQLYLKLTCVLSPLTKTLNHMDLHWCFFTILLFFSYPNLISCDQEGFWSLSCGSATNFIDSSNISWVSDYNYITKGNTTIVDSNESIRFFPHPRSRNCYKLPLNYASSSLILIRVSFVYKNYDGLQQPPLFSVSFGTAIFATVNLSVKDPWVEEFIWRIEKENVLLCLNSIPNGGIPVISSIEFRPTPQGGYYNGMEDFTNKLIRKRYRINCGFTNGSIRYPLDQYDRIWDPDQDFSPFHTSIGFNILDTFNTWALTESP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018678`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018678

Location Chr04:16556968-16562416 (-)

Description Similar to At5g48740: Probable LRR receptor-like serine/threonine-protein kinase At5g48740

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48740`	Probable LRR receptor-like serine/threonine-protein kinase At5g48740.	No verified direct reference in this release
`At1g67720`	Probable LRR receptor-like serine/threonine-protein kinase At1g67720.	No verified direct reference in this release
`At2g14510`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510.	No verified direct reference in this release
`At2g14440`	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018678 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009877 nodulation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G67720

ath:AT2G14510

ath:AT5G48740

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.792

Rank 1 · LXL04_018678 · OH-1004

Endoplasmic reticulum0.105

Rank 2 · LXL04_018678 · OH-1004

Cytoplasm0.082

Rank 3 · LXL04_018678 · OH-1004

Lysosome / Vacuole0.055

Rank 4 · LXL04_018678 · OH-1004

Nucleus0.046

Rank 5 · LXL04_018678 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12819.14Malectin_like50-359 aa

PF12799.14LRR_4430-472 aa

PF13855.13LRR_8452-510 aa

PF07714.24PK_Tyr_Ser-Thr637-903 aa

PF00069.32Pkinase637-903 aa

PF03109.23ABC1699-799 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018678	`PF12819.14`	Malectin_like	50	359	1.9e-46	159.6
LXL04_018678	`PF12799.14`	LRR_4	430	472	2.2e-08	34.8
LXL04_018678	`PF13855.13`	LRR_8	452	510	4.7e-08	33.4
LXL04_018678	`PF07714.24`	PK_Tyr_Ser-Thr	637	903	1.5e-46	159.5
LXL04_018678	`PF00069.32`	Pkinase	637	903	5e-46	157.9
LXL04_018678	`PF03109.23`	ABC1	699	799	4.1e-07	30.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGV0`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At5g48740	58.518%	Swiss-Prot	strong database homology
`C0LGI2`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g67720	33.438%	Swiss-Prot	moderate database homology
`Q9ZQR3`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510	33.189%	Swiss-Prot	moderate database homology
`Q9ZQQ7`	Arabidopsis thaliana	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440	32.465%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card