LXL04_018676 | RubberDandelionOmics

Gene overview

LXL04_018676

Reference: OH-1004 Chr: Chr04 Coordinates: 16548507-16550075 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1569 bp · LXL04_018676|LXL04_018676|OH1004|cDNA

ATGGCTACCGCTACTCCCTCCCCACCTACTATGGCATCacatgaagaagaagaagaagataacaacaacaacagcatcCAGCAATCGCCAACTCTGCAGGAGTCGGTCCCGTCACCGCCGTCACCAATTGAAGACGTAGACCAGCACCAGCAATTAGCAAGCTCAAATTCACCTTATTCGCCTGGGACAACCGTCGGAACACCGGAGAAGCCTGTCGGTTGTGAACATCCGCCACCTGAAGATGTCGGAGATGAACAGGA...

CDS

Download CDS FASTA

1569 bp · LXL04_018676|LXL04_018676|OH1004|CDS

ATGGCTACCGCTACTCCCTCCCCACCTACTATGGCATCACATGAAGAAGAAGAAGAAGATAACAACAACAACAGCATCCAGCAATCGCCAACTCTGCAGGAGTCGGTCCCGTCACCGCCGTCACCAATTGAAGACGTAGACCAGCACCAGCAATTAGCAAGCTCAAATTCACCTTATTCGCCTGGGACAACCGTCGGAACACCGGAGAAGCCTGTCGGTTGTGAACATCCGCCACCTGAAGATGTCGGAGATGAACAGGA...

Protein

Download Protein FASTA

522 aa · LXL04_018676|LXL04_018676|OH1004|PROTEIN

MATATPSPPTMASHEEEEEDNNNNSIQQSPTLQESVPSPPSPIEDVDQHQQLASSNSPYSPGTTVGTPEKPVGCEHPPPEDVGDEQEPEPELEPVPASPPPQDKILDSEQLSGPPSPSSILPPSPTQTPPPTEHEHPPENLSPSHESPTSKQSLSPPTRAEEPVESPNYRETPNPNPNSDHESPSPSSPTAIQVNPSPKPHESPKELSPSPPPTAASPTSPPLEQQQQQLATAVVTWSPNKPQVLPWTHQETANLIQAYQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018676`
TK1151 ID	TkA08G077750
OH-1004 ID	LXL04_018676
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 98.084 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018676

Location Chr04:16548507-16550075 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14180`	Transcription regulator that may repress the maturation program during early embryogenesis.	MicroRNAs regulate the timing of embryo maturation in Arabidopsis.2011 · DOI: 10.1104/pp.110.171355
`At4g17060`	Protein FIP2.	No verified direct reference in this release
`At3g11100`	Transcription regulator.	Interaction of Arabidopsis Trihelix-Domain Transcription Factors VFP3 and VFP5 with Agrobacterium Virulence Protein VirF.2015 · DOI: 10.1371/journal.pone.0142128

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018676 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042393 histone binding Molecular Function

KEGG gene cross-reference

ath:AT3G11100

ath:AT3G14180

ath:AT4G17060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.978

Rank 1 · LXL04_018676 · OH-1004

Cytoplasm0.068

Rank 2 · LXL04_018676 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_018676 · OH-1004

Endoplasmic reticulum0.023

Rank 4 · LXL04_018676 · OH-1004

Plastid0.012

Rank 5 · LXL04_018676 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837.13Myb_DNA-bind_4247-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018676	`PF13837.13`	Myb_DNA-bind_4	247	333	7.3e-16	59.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJG8`	Arabidopsis thaliana	Trihelix transcription factor ASIL2	36.957%	Swiss-Prot	weak database homology
`O23550`	Arabidopsis thaliana	Protein FIP2	41.379%	Swiss-Prot	weak database homology
`Q8VZI9`	Arabidopsis thaliana	Trihelix transcription factor ENAP1	39.175%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card