LXL04_018641 | RubberDandelionOmics

Gene overview

LXL04_018641

Reference: OH-1004 Chr: Chr04 Coordinates: 16144890-16151554 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2860 bp · LXL04_018641|LXL04_018641|OH1004|cDNA

ATGGAGTCTCTGCAACAGAGAGTAGAATCATGGATCAGAGACCAAAGAACAAAGCTCTTGAAGGTCACTTGGCCACAACAATGGCCTACTGCTATGAAATGGCCTTGGATCAAAGGGAGAGAACACAGGAAACGAATGCAAGAAGAGTTTAAGAGGCGGAAAAAGCAACTTCACAATCTCTGTATCGCCCTTAAGGCCGACTCACTTTCGGATTTGCAGGATGTTCTTTGCTGTATGGTGCTTTCTGAGTGTGTTTACAA...

CDS

Download CDS FASTA

2853 bp · LXL04_018641|LXL04_018641|OH1004|CDS

ATGGAGTCTCTGCAACAGAGAGTAGAATCATGGATCAGAGACCAAAGAACAAAGCTCTTGAAGGTCACTTGGCCACAACAATGGCCTACTGCTATGAAATGGCCTTGGATCAAAGGGAGAGAACACAGGAAACGAATGCAAGAAGAGTTTAAGAGGCGGAAAAAGCAACTTCACAATCTCTGTATCGCCCTTAAGGCCGACTCACTTTCGGATTTGCAGGATGTTCTTTGCTGTATGGTGCTTTCTGAGTGTGTTTACAA...

Protein

Download Protein FASTA

950 aa · LXL04_018641|LXL04_018641|OH1004|PROTEIN

MESLQQRVESWIRDQRTKLLKVTWPQQWPTAMKWPWIKGREHRKRMQEEFKRRKKQLHNLCIALKADSLSDLQDVLCCMVLSECVYKRPDAELVQAVNKFKADFDCQVVSLERIQPSSDHVPHRYLLAETGDTLFASFIGTKQYKDMMADANILQAAIFHDDAIEDTEEILTKNMPQVDNVPKTIGSKPQGVTSTKPAAHRGFMSRAKGIPALELYKLAQKKKRKLVLCGHSLGGAVAVLSTLAILRVIAAASSSKEHEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018641`
TK1151 ID	TkA08G074130
OH-1004 ID	LXL04_018641
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 99.363 / OH-1004 49.263 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018641

Location Chr04:16144890-16151554 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48080`	Acts as a second functional copy of EDS1.	No verified direct reference in this release
`At3g48090`	Positive regulator of basal resistance and of effector-triggered immunity specifically mediated by TIR-NB-LRR (TNL) resistance proteins.	EDS1, an essential component of R gene-mediated disease resistance in Arabidopsis has homology to eukaryotic lipases.1999 · DOI: 10.1073/pnas.96.6.3292 Direct interaction between the Arabidopsis disease resistance signaling proteins, EDS1 and PAD4.2001 · DOI: 10.1093/emboj/20.19.5400 Arabidopsis SENESCENCE-ASSOCIATED GENE101 stabilizes and signals within an ENHANCED DISEASE SUSCEPTIBILITY1 complex in plant innate immunity.2005 · DOI: 10.1105/tpc.105.033910 Balanced nuclear and cytoplasmic activities of EDS1 are required for a complete plant innate immune response.2010 · DOI: 10.1371/journal.ppat.1000970 Different roles of Enhanced Disease Susceptibility1 (EDS1) bound to and dissociated from Phytoalexin Deficient4 (PAD4) in Arabidopsis immunity.2011 · DOI: 10.1111/j.1469-8137.2011.03675.x Pathogen effectors target Arabidopsis EDS1 and alter its interactions with immune regulators.2011 · DOI: 10.1126/science.1211592 EDS1 contributes to nonhost resistance of Arabidopsis thaliana against Erwinia amylovora.2012 · DOI: 10.1094/mpmi-05-11-0111 Contrasting Roles of the Apoplastic Aspartyl Protease APOPLASTIC, ENHANCED DISEASE SUSCEPTIBILITY1-DEPENDENT1 and LEGUME LECTIN-LIKE PROTEIN1 in Arabidopsis Systemic Acquired Resistance.2014 · DOI: 10.1104/pp.114.239665
`UniProt: Q9XF23`	Positive regulator of basal resistance and of effector-triggered immunity specifically mediated by TIR-NB-LRR resistance proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018641 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000304 response to singlet oxygen Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0010310 regulation of hydrogen peroxide metabolic process Biological Process

GO:0010618 aerenchyma formation Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

GO:0060866 leaf abscission Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G48080

ath:AT3G48090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.284

Rank 1 · LXL04_018641 · OH-1004

Cytoplasm0.225

Rank 2 · LXL04_018641 · OH-1004

Endoplasmic reticulum0.160

Rank 3 · LXL04_018641 · OH-1004

Nucleus0.148

Rank 4 · LXL04_018641 · OH-1004

Plastid0.137

Rank 5 · LXL04_018641 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01764.32Lipase_3187-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018641	`PF01764.32`	Lipase_3	187	304	5.4e-16	59.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU71`	Arabidopsis thaliana	Protein EDS1B	31.034%	Swiss-Prot	weak database homology
`Q9SU72`	Arabidopsis thaliana	Protein EDS1	29.213%	Swiss-Prot	weak database homology
`Q9XF23`	Arabidopsis thaliana	Protein EDS1L	29.545%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card