LXL04_018614 | RubberDandelionOmics

Gene overview

LXL04_018614

Reference: OH-1004 Chr: Chr04 Coordinates: 15655830-15656772 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

552 bp · LXL04_018614|LXL04_018614|OH1004|cDNA

GGACCAATCAGAACGAAGGAAACACGTCAGGCACCAATAGACCGAGAAACCATAACCAGTAGAGAAGCTCGATCTGCAGCGACTGCTCTAGATACAAATTTGCATATCTATAACTACATCAGAATGCTTTGGAGGAAAGTCTTGTTCATCTGTTTCGTTATTCTGCCAATAACTATCACCACTGCTATTCCAGAATCTTCGGATGCATCTCAGGTCAGATGCAGCAAGCGATGCGTGGCAGAAAACTGTAACTCTCTTGG...

CDS

Download CDS FASTA

453 bp · LXL04_018614|LXL04_018614|OH1004|CDS

TTGCATATCTATAACTACATCAGAATGCTTTGGAGGAAAGTCTTGTTCATCTGTTTCGTTATTCTGCCAATAACTATCACCACTGCTATTCCAGAATCTTCGGATGCATCTCAGGTCAGATGCAGCAAGCGATGCGTGGCAGAAAACTGTAACTCTCTTGGGATTAGATACGGGAAGTACTGTGGCGTTGGATGGACTGGATGTCCAGGTGAAAGCCCCTGCGATGATCTCGATGCGTGTTGTCAGATTCACGATGAATG...

Protein

Download Protein FASTA

150 aa · LXL04_018614|LXL04_018614|OH1004|PROTEIN

MHIYNYIRMLWRKVLFICFVILPITITTAIPESSDASQVRCSKRCVAENCNSLGIRYGKYCGVGWTGCPGESPCDDLDACCQIHDECVEKKGMTNVKCHEKFKRCIKKVQKSGKAGFSRDCPINTAVPTMQQGMDMAILFSQFGNSKLEL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018614`
TK1151 ID	TkA08G072300
OH-1004 ID	LXL04_018614
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 81.967 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018614

Location Chr04:15655830-15656772 (+)

Description Similar to PLA2-I: Probable phospholipase A2 homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19690`	PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.	No verified direct reference in this release
`At4g29460`	PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.	No verified direct reference in this release
`At4g29470`	PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.	No verified direct reference in this release
`At2g06925`	PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0831700`	PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018614 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006644 phospholipid metabolic process Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009555 pollen development Biological Process

GO:0009630 gravitropism Biological Process

GO:0009733 response to auxin Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0030307 positive regulation of cell growth Biological Process

GO:0050482 arachidonate secretion Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT2G06925

ath:AT2G19690

ath:AT4G29460

ath:AT4G29470

dosa:Os02g0831700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.491

Rank 1 · LXL04_018614 · OH-1004

Cytoplasm0.180

Rank 2 · LXL04_018614 · OH-1004

Cell membrane0.173

Rank 3 · LXL04_018614 · OH-1004

Lysosome / Vacuole0.148

Rank 4 · LXL04_018614 · OH-1004

Golgi apparatus0.124

Rank 5 · LXL04_018614 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GZB4`	Arabidopsis thaliana	Phospholipase A2-beta	56.557%	Swiss-Prot	strong database homology
`Q9M0D7`	Arabidopsis thaliana	Phospholipase A2-gamma	59.483%	Swiss-Prot	strong database homology
`Q8GV50`	Arabidopsis thaliana	Phospholipase A2-delta	55.652%	Swiss-Prot	strong database homology
`Q8S8N6`	Arabidopsis thaliana	Phospholipase A2-alpha	30.370%	Swiss-Prot	moderate database homology
`Q9XG80`	Oryza sativa subsp. japonica	Probable phospholipase A2 homolog 1	68.868%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card