LXL04_018503 | RubberDandelionOmics

Gene overview

LXL04_018503

Reference: OH-1004 Chr: Chr04 Coordinates: 13860403-13862912 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1383 bp · LXL04_018503|LXL04_018503|OH1004|cDNA

ATGGGAAGATCATTCCGTTATGTGATAATCGGTGGAGGTGTCGCTGCTGGTTATGCAGCTCTCGAATTCACCAAAAAAGGCGTCTCTCATGGTGAACTCTGCATCATCTCCGACGAACCTGTGGCTCCTTATGAGCGACCAGCACTCAGCAAAGGGTTTCTACTTCCAGAAGCTCCTGCACGTCTCCCTGGCTTTCATACTTGTGTAGGTGCCAATGAAGAGAGGTTAACACCCAATTGGTACAAAGAACATGGGATAGA...

CDS

Download CDS FASTA

1383 bp · LXL04_018503|LXL04_018503|OH1004|CDS

ATGGGAAGATCATTCCGTTATGTGATAATCGGTGGAGGTGTCGCTGCTGGTTATGCAGCTCTCGAATTCACCAAAAAAGGCGTCTCTCATGGTGAACTCTGCATCATCTCCGACGAACCTGTGGCTCCTTATGAGCGACCAGCACTCAGCAAAGGGTTTCTACTTCCAGAAGCTCCTGCACGTCTCCCTGGCTTTCATACTTGTGTAGGTGCCAATGAAGAGAGGTTAACACCCAATTGGTACAAAGAACATGGGATAGA...

Protein

Download Protein FASTA

460 aa · LXL04_018503|LXL04_018503|OH1004|PROTEIN

MGRSFRYVIIGGGVAAGYAALEFTKKGVSHGELCIISDEPVAPYERPALSKGFLLPEAPARLPGFHTCVGANEERLTPNWYKEHGIELILGTRVESIDVRRKTLLTTTGETISYKFLIIATGSRAVKLEEIGIKGSDAENVCYLHDLADATNLVNIMQKCSGGNAIVVGGGYIGMECAASLVANKINVSIVFPGPHCMERLFTPKIASYYEDFYKSKGVNFVKGTSLSSFEFNSEGMVTGANLRDGRQLPADMIVVGIGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018503`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018503

Location Chr04:13860403-13862912 (-)

Description Similar to MDAR4: Monodehydroascorbate reductase 4, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27820`	Catalyzes the conversion of monodehydroascorbate to ascorbate, oxidizing NADH in the process.	Arabidopsis peroxisomes possess functionally redundant membrane and matrix isoforms of monodehydroascorbate reductase.2005 · DOI: 10.1111/j.1365-313x.2005.02503.x MONODEHYROASCORBATE REDUCTASE4 is required for seed storage oil hydrolysis and postgerminative growth in Arabidopsis.2007 · DOI: 10.1105/tpc.106.043992

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0707100`	Catalyzes the conversion of monodehydroascorbate to ascorbate, oxidizing NADH in the process.	No verified direct reference in this release
`Os02g0707000`	Catalyzes the conversion of monodehydroascorbate to ascorbate, oxidizing NADH in the process.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018503 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016656 monodehydroascorbate reductase (NADH) activity Molecular Function

KEGG gene cross-reference

ath:AT3G27820

dosa:Os02g0707000

dosa:Os02g0707100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.399

Rank 1 · LXL04_018503 · OH-1004

Cytoplasm0.269

Rank 2 · LXL04_018503 · OH-1004

Peroxisome0.220

Rank 3 · LXL04_018503 · OH-1004

Plastid0.132

Rank 4 · LXL04_018503 · OH-1004

Nucleus0.104

Rank 5 · LXL04_018503 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07992.21Pyr_redox_26-320 aa

PF13738.13Pyr_redox_385-295 aa

PF00070.34Pyr_redox165-244 aa

PF21791.4MDHAR3-like_C340-416 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018503	`PF07992.21`	Pyr_redox_2	6	320	3.6e-57	194.7
LXL04_018503	`PF13738.13`	Pyr_redox_3	85	295	2.2e-08	34.5
LXL04_018503	`PF00070.34`	Pyr_redox	165	244	6.9e-18	65.7
LXL04_018503	`PF21791.4`	MDHAR3-like_C	340	416	6.3e-31	107.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK94`	Arabidopsis thaliana	Monodehydroascorbate reductase 4, peroxisomal	65.975%	Swiss-Prot	strong database homology
`Q8S3R2`	Oryza sativa subsp. japonica	Monodehydroascorbate reductase 2, peroxisomal	63.617%	Swiss-Prot	strong database homology
`Q8S3R1`	Oryza sativa subsp. japonica	Monodehydroascorbate reductase 1, peroxisomal	62.418%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card