LXL04_018502 | RubberDandelionOmics

Gene overview

LXL04_018502

Reference: OH-1004 Chr: Chr04 Coordinates: 13856918-13859782 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1566 bp · LXL04_018502|LXL04_018502|OH1004|cDNA

ATGAAACAAGGATTTGTGATTTTGATTTCATTCGTGTTCTTGTTGTTGAGTAGTAGTAGCAGTAATAATCGGTTAGTAAGGGCAGAGACAGAGTCCCATCATGATCAGTGCAAAGCATGGCTTGTTCAATCGATTCCCACCGACATGCCCGAACTCTCACTCGTCCCCGGTGTTCTCTCCACCGCGGACGTGTTCAGATGGTTAGCCGGAAACTCTTCCGACAACCTCGACATAATGGCACAGTACTGGCAGCTAATCGC...

CDS

Download CDS FASTA

1566 bp · LXL04_018502|LXL04_018502|OH1004|CDS

ATGAAACAAGGATTTGTGATTTTGATTTCATTCGTGTTCTTGTTGTTGAGTAGTAGTAGCAGTAATAATCGGTTAGTAAGGGCAGAGACAGAGTCCCATCATGATCAGTGCAAAGCATGGCTTGTTCAATCGATTCCCACCGACATGCCCGAACTCTCACTCGTCCCCGGTGTTCTCTCCACCGCGGACGTGTTCAGATGGTTAGCCGGAAACTCTTCCGACAACCTCGACATAATGGCACAGTACTGGCAGCTAATCGC...

Protein

Download Protein FASTA

521 aa · LXL04_018502|LXL04_018502|OH1004|PROTEIN

MKQGFVILISFVFLLLSSSSSNNRLVRAETESHHDQCKAWLVQSIPTDMPELSLVPGVLSTADVFRWLAGNSSDNLDIMAQYWQLIAQPNDTRSGDYGYSEENMKNFGSDEGSSVYKSIEDAADRDVDVRLLQHSGVYPDYTAEPSELASGRPNVKNVTLLIKDWFDSGVLHAKVWISDSRDVYIGSANNDWKSLTQVKEVGIYLVNCTKIAKKVKVFYNNLWKLGSLNSSDYTRKIWDQQWQISRTVPCWSHFIPLKKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018502`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_018502`
Location	Chr04:13856918-13859782 (+)
Description	Similar to pldY: Phospholipase D Y
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018502` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0002376 immune system process Biological Process GO:0006629 lipid metabolic process Biological Process GO:0016042 lipid catabolic process Biological Process GO:0034164 negative regulation of toll-like receptor 9 signaling pathway Biological Process GO:0044351 macropinocytosis Biological Process GO:1905367 positive regulation of intralumenal vesicle formation Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005764 lysosome Cellular Component GO:0005765 lysosomal membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0012505 endomembrane system Cellular Component
KEGG gene cross-reference	ddi:DDB_G0287649 hsa:23646 pon:100173883 xla:398831 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.499

Rank 1 · LXL04_018502 · OH-1004

Golgi apparatus0.191

Rank 2 · LXL04_018502 · OH-1004

Cytoplasm0.179

Rank 3 · LXL04_018502 · OH-1004

Extracellular0.156

Rank 4 · LXL04_018502 · OH-1004

Cell membrane0.156

Rank 5 · LXL04_018502 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13918.13PLDc_3108-224 aa

PF13091.13PLDc_2112-223 aa

PF13918.13PLDc_3304-395 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018502	`PF13918.13`	PLDc_3	108	224	3e-20	73.5
LXL04_018502	`PF13091.13`	PLDc_2	112	223	1.5e-15	57.9
LXL04_018502	`PF13918.13`	PLDc_3	304	395	3e-20	73.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card