LXL04_018494 | RubberDandelionOmics

Gene overview

LXL04_018494

Reference: OH-1004 Chr: Chr04 Coordinates: 13757098-13759759 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1929 bp · LXL04_018494|LXL04_018494|OH1004|cDNA

ATGTCAATTATGTTATCTTCTTCGCCTCTACTTTCTTCAAGAACTCCAACCCTAATCCTGAAGCTACACAATCACATTGAATTGAACCCTTCAGTTCGTCTTCTCCGTTCTACAGGTTTacacaacaaaaacatcaagtACAAGGATTCATTCGTTGCTTTATCAGTAAACGGCAACCTATCAGTAACACACACAACCAATTCGagaaaaaaacataaaaaaccACCGCCCCTTTTAAGCGAGGGAAGAGACGATGACGA...

CDS

Download CDS FASTA

1929 bp · LXL04_018494|LXL04_018494|OH1004|CDS

ATGTCAATTATGTTATCTTCTTCGCCTCTACTTTCTTCAAGAACTCCAACCCTAATCCTGAAGCTACACAATCACATTGAATTGAACCCTTCAGTTCGTCTTCTCCGTTCTACAGGTTTACACAACAAAAACATCAAGTACAAGGATTCATTCGTTGCTTTATCAGTAAACGGCAACCTATCAGTAACACACACAACCAATTCGAGAAAAAAACATAAAAAACCACCGCCCCTTTTAAGCGAGGGAAGAGACGATGACGA...

Protein

Download Protein FASTA

642 aa · LXL04_018494|LXL04_018494|OH1004|PROTEIN

MSIMLSSSPLLSSRTPTLILKLHNHIELNPSVRLLRSTGLHNKNIKYKDSFVALSVNGNLSVTHTTNSRKKHKKPPPLLSEGRDDDDSLGLVCPGCGVFMQDNDPTLPGYYQKKKEIEVTDALDDIAGELDDIDEDEGKEEEEEEGELDSEIDDELDDGLEIEDELDWDSDWEPEFEDDDDNLSKELDGFTAPGVGYGNITEEVLEKGKNKRVSKSERKKLAREEAQVPKEEVTVCARCHSLRNYGQVKNQNVENLIPDF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018494`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018494

Location Chr04:13757098-13759759 (-)

Description Similar to BPG2: GTP-binding protein BRASSINAZOLE INSENSITIVE PALE GREEN 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57180`	Required for brassinosteroid- (BR) mediated post-transcriptional and translational regulation in the chloroplast, including accumulation of chloroplast rRNA.	The chloroplast protein BPG2 functions in brassinosteroid-mediated post-transcriptional accumulation of chloroplast rRNA.2010 · DOI: 10.1111/j.1365-313x.2009.04077.x Arabidopsis BPG2: a phytochrome-regulated gene whose protein product binds to plastid ribosomal RNAs.2012 · DOI: 10.1007/s00425-012-1638-6
`At3g47450`	Exhibits cGTPase activity.	AtNOS/AtNOA1 is a functional Arabidopsis thaliana cGTPase and not a nitric-oxide synthase.2008 · DOI: 10.1074/jbc.m804838200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0104700`	Produces nitric oxide (NO) which is a messenger molecule involved in hormonal signaling and defense responses in plant.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018494 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006809 nitric oxide biosynthetic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009657 plastid organization Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010027 thylakoid membrane organization Biological Process

KEGG gene cross-reference

ath:AT3G47450

ath:AT3G57180

bsu:BSU25670

dosa:Os02g0104700

mmu:56412

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.864

Rank 1 · LXL04_018494 · OH-1004

Mitochondrion0.095

Rank 2 · LXL04_018494 · OH-1004

Nucleus0.052

Rank 3 · LXL04_018494 · OH-1004

Cytoplasm0.020

Rank 4 · LXL04_018494 · OH-1004

Cell membrane0.012

Rank 5 · LXL04_018494 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28564.1GEP3_N93-127 aa

PF01926.30MMR_HSR1390-459 aa

PF21516.3YqeH-like_C506-603 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018494	`PF28564.1`	GEP3_N	93	127	8.6e-08	33.6
LXL04_018494	`PF01926.30`	MMR_HSR1	390	459	5.9e-10	40.0
LXL04_018494	`PF21516.3`	YqeH-like_C	506	603	8.9e-14	52.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4I6`	Arabidopsis thaliana	GTP-binding protein BRASSINAZOLE INSENSITIVE PALE GREEN 2, chloroplastic	65.391%	Swiss-Prot	strong database homology
`Q66GP9`	Arabidopsis thaliana	NO-associated protein 1, chloroplastic/mitochondrial	27.607%	Swiss-Prot	weak database homology
`Q6YPG5`	Oryza sativa subsp. japonica	Putative nitric oxide synthase	27.123%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card