RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_018445
Reference: OH-1004 Chr: Chr04 Coordinates: 13052827-13057818 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2844 bp · LXL04_018445|LXL04_018445|OH1004|cDNA

ATGGCTGGCTCTGCAAAAGCTCTCGAACCTGCATTCCAAGGAGTTGGTCAAAGAGTAGGGACTGAAATATGGAGAATCGAAAACTTCCAGCCTACACCTTTGCCTAAATCCAACTACGGCAAATTCTACTCCGGTGATTCATACATCGTATTACAGACTACTTCTGGTAAAGGAGGTGCTTATAACTACGACATACATTTCTGGCTAGGAAAAGATACTAGCCAGGATGAAGCGGGGACCGCAGCGATAAAAACGGTTGA...

CDS

Download CDS FASTA

2844 bp · LXL04_018445|LXL04_018445|OH1004|CDS

ATGGCTGGCTCTGCAAAAGCTCTCGAACCTGCATTCCAAGGAGTTGGTCAAAGAGTAGGGACTGAAATATGGAGAATCGAAAACTTCCAGCCTACACCTTTGCCTAAATCCAACTACGGCAAATTCTACTCCGGTGATTCATACATCGTATTACAGACTACTTCTGGTAAAGGAGGTGCTTATAACTACGACATACATTTCTGGCTAGGAAAAGATACTAGCCAGGATGAAGCGGGGACCGCAGCGATAAAAACGGTTGA...

Protein

Download Protein FASTA

947 aa · LXL04_018445|LXL04_018445|OH1004|PROTEIN

MAGSAKALEPAFQGVGQRVGTEIWRIENFQPTPLPKSNYGKFYSGDSYIVLQTTSGKGGAYNYDIHFWLGKDTSQDEAGTAAIKTVELDACLGGRAVQYRELQGHESDKFLSYFKPCIIPLEGGVASGFKEVEEEEFQIRLYTCKGKRVVRLKQVPFSRSTLNHDDVFILDTKEKIFQFNGANSNIQERAKALEVIQFLKDKYHDGTCDVAIVDDGKLQAEGDSGEFWVIFGGFAPIGKKVASEDDIIPEKTSPKLFCIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_018445
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_018445
LocationChr04:13052827-13057818 (+)
DescriptionSimilar to VLN2: Villin-2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g41740 May act as a Ca²⁺-regulated actin-binding protein.
Arabidopsis VILLIN2 and VILLIN3 are required for the generation of thick actin filament bundles and for directional organ growth.2012 · DOI: 10.1104/pp.111.192385
Arabidopsis VILLIN2 and VILLIN3 act redundantly in sclerenchyma development via bundling of actin filaments.2012 · DOI: 10.1111/j.1365-313x.2012.05044.x
Arabidopsis villins promote actin turnover at pollen tube tips and facilitate the construction of actin collars.2013 · DOI: 10.1105/tpc.113.110940
At3g57410 Binds actin and actin bundles independently of Ca²⁺, but severs actin filaments in a calcium-dependent manner.
Arabidopsis VILLIN1 and VILLIN3 have overlapping and distinct activities in actin bundle formation and turnover.2010 · DOI: 10.1105/tpc.110.076240
Arabidopsis VILLIN2 and VILLIN3 are required for the generation of thick actin filament bundles and for directional organ growth.2012 · DOI: 10.1104/pp.111.192385
Arabidopsis VILLIN2 and VILLIN3 act redundantly in sclerenchyma development via bundling of actin filaments.2012 · DOI: 10.1111/j.1365-313x.2012.05044.x
At4g30160 Binds actin and actin bundles independently of Ca²⁺, but caps filament barbed ends and severs filaments in a calcium-dependent manner.
Arabidopsis VILLIN4 is involved in root hair growth through regulating actin organization in a Ca2+-dependent manner.2011 · DOI: 10.1111/j.1469-8137.2010.03632.x
The universal bundling activity of AtVLN4 in diffusely growing cells.2011 · DOI: 10.4161/psb.6.9.16501
At5g57320 Major actin filament stabilizing factor and regulator of actin dynamics.
Arabidopsis VILLIN5, an actin filament bundling and severing protein, is necessary for normal pollen tube growth.2010 · DOI: 10.1105/tpc.110.076257
Arabidopsis villins promote actin turnover at pollen tube tips and facilitate the construction of actin collars.2013 · DOI: 10.1105/tpc.113.110940

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0356700 Ca(2+)-regulated actin-binding protein (By similarity).
VLN2 Regulates Plant Architecture by Affecting Microfilament Dynamics and Polar Auxin Transport in Rice.2015 · DOI: 10.1105/tpc.15.00581
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018445 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0001558 regulation of cell growth Biological Process
GO:0007015 actin filament organization Biological Process
GO:0009630 gravitropism Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0030042 actin filament depolymerization Biological Process
GO:0048767 root hair elongation Biological Process
GO:0051014 actin filament severing Biological Process
GO:0051017 actin filament bundle assembly Biological Process
GO:0051693 actin filament capping Biological Process
GO:0051764 actin crosslink formation Biological Process
GO:0099636 cytoplasmic streaming Biological Process
GO:2000012 regulation of auxin polar transport Biological Process
KEGG gene cross-reference
ath:AT2G41740
ath:AT3G57410
ath:AT4G30160
ath:AT5G57320
dosa:Os03g0356700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.708
Rank 1 · LXL04_018445 · OH-1004
Cell membrane0.214
Rank 2 · LXL04_018445 · OH-1004
Nucleus0.187
Rank 3 · LXL04_018445 · OH-1004
Golgi apparatus0.116
Rank 4 · LXL04_018445 · OH-1004
Endoplasmic reticulum0.074
Rank 5 · LXL04_018445 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00626.28Gelsolin29-111 aa
PF00626.28Gelsolin150-220 aa
PF00626.28Gelsolin264-337 aa
PF25480.2DUF7904397-486 aa
PF00626.28Gelsolin406-483 aa
PF00626.28Gelsolin532-582 aa
PF00626.28Gelsolin646-719 aa
PF02209.25VHP912-947 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_018445PF00626.28Gelsolin291112.6e-73242.6
LXL04_018445PF00626.28Gelsolin1502202.6e-73242.6
LXL04_018445PF00626.28Gelsolin2643372.6e-73242.6
LXL04_018445PF25480.2DUF79043974867.4e-1968.1
LXL04_018445PF00626.28Gelsolin4064832.6e-73242.6
LXL04_018445PF00626.28Gelsolin5325822.6e-73242.6
LXL04_018445PF00626.28Gelsolin6467192.6e-73242.6
LXL04_018445PF02209.25VHP9129478.5e-1658.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O81644Arabidopsis thalianaVillin-267.071%Swiss-Protstrong database homology
O81645Arabidopsis thalianaVillin-367.919%Swiss-Protstrong database homology
O65570Arabidopsis thalianaVillin-448.938%Swiss-Protmoderate database homology
Q9LVC6Arabidopsis thalianaVillin-546.429%Swiss-Protmoderate database homology
Q10L71Oryza sativa subsp. japonicaVillin-261.212%Swiss-Protstrong database homology

JBrowse

View in Genome Browser