LXL04_018362 | RubberDandelionOmics

Gene overview

LXL04_018362

Reference: OH-1004 Chr: Chr04 Coordinates: 12107566-12112564 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3030 bp · LXL04_018362|LXL04_018362|OH1004|cDNA

ATGTCCTTTCGCCATGAAAAAGGCGTCAATGTCCAGGTGCTATTGCGTTGCAGGCCGTTTAGTAGCGACGAGTTAAAGAACAATGCACCTCAGGTGGTAACGTGTAACGAGTATCAGAGAGAAGTTGCGGTTTCGCAGAGTATTGCTGGGAAGCAAATAGATAGGGTTTTTACATTTGACAAGGTTTTTGGCCCTAAAGCTCAGCAAAAAGATTTATACGAAGAAGCTGTAATACCAATTGTAAACGAAGTTCTAGAAGG...

CDS

Download CDS FASTA

3030 bp · LXL04_018362|LXL04_018362|OH1004|CDS

ATGTCCTTTCGCCATGAAAAAGGCGTCAATGTCCAGGTGCTATTGCGTTGCAGGCCGTTTAGTAGCGACGAGTTAAAGAACAATGCACCTCAGGTGGTAACGTGTAACGAGTATCAGAGAGAAGTTGCGGTTTCGCAGAGTATTGCTGGGAAGCAAATAGATAGGGTTTTTACATTTGACAAGGTTTTTGGCCCTAAAGCTCAGCAAAAAGATTTATACGAAGAAGCTGTAATACCAATTGTAAACGAAGTTCTAGAAGG...

Protein

Download Protein FASTA

1009 aa · LXL04_018362|LXL04_018362|OH1004|PROTEIN

MSFRHEKGVNVQVLLRCRPFSSDELKNNAPQVVTCNEYQREVAVSQSIAGKQIDRVFTFDKVFGPKAQQKDLYEEAVIPIVNEVLEGFNCTIFAYGQTGTGKTYTMEGECKRAKSGPNGELPLEAGVIPRSVKQIFDTLEGQNAEYSVKVTFLELYNEEITDLLAPEEVSKVGVEDKQKKLLPLMEDGKGGVLVRGLEEEIVTSASEIFTLLERGSAKRRTAETLLNKQSSRSHSLFSITIHIKESTPEGEELIKCGKLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018362`
TK1151 ID	TkA08G057260
OH-1004 ID	LXL04_018362
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 92.929 / OH-1004 63.826 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018362

Location Chr04:12107566-12112564 (+)

Description Similar to KIN5C: Kinesin-like protein KIN-5C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36200`	Responsible for microtubule translocation.	No verified direct reference in this release
`At3g45850`	Responsible for microtubule translocation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0558400`	Responsible for microtubule translocation.	No verified direct reference in this release
`Os05g0117798`	Responsible for microtubule translocation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018362 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007018 microtubule-based movement Biological Process

GO:0051231 spindle elongation Biological Process

GO:0090307 mitotic spindle assembly Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005876 spindle microtubule Cellular Component

GO:0072686 mitotic spindle Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008017 microtubule binding Molecular Function

GO:0008574 plus-end-directed microtubule motor activity Molecular Function

KEGG gene cross-reference

ath:AT2G36200

dosa:Os05g0117798

nta:107774014

osa:9268593

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.761

Rank 1 · LXL04_018362 · OH-1004

Nucleus0.220

Rank 2 · LXL04_018362 · OH-1004

Cell membrane0.073

Rank 3 · LXL04_018362 · OH-1004

Golgi apparatus0.068

Rank 4 · LXL04_018362 · OH-1004

Mitochondrion0.062

Rank 5 · LXL04_018362 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796.12Microtub_bd10-164 aa

PF00225.30Kinesin16-357 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018362	`PF16796.12`	Microtub_bd	10	164	2.3e-25	90.1
LXL04_018362	`PF00225.30`	Kinesin	16	357	4.4e-115	384.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P82266`	Arabidopsis thaliana	Kinesin-like protein KIN-5C	67.260%	Swiss-Prot	strong database homology
`Q9LZU5`	Arabidopsis thaliana	Kinesin-like protein KIN-5D	48.638%	Swiss-Prot	moderate database homology
`B7EJ91`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-5C	63.897%	Swiss-Prot	strong database homology
`Q5W7C6`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-5A	47.711%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card