LXL04_018347 | RubberDandelionOmics

Gene overview

LXL04_018347

Reference: OH-1004 Chr: Chr04 Coordinates: 11891741-11892247 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · LXL04_018347|LXL04_018347|OH1004|cDNA

ATGTTTAATCTCGTCGGCAGAAACTTGACAATTTCTGTATTCAAATCATCATCGGTTCATAGATTATTTCTTCGCACATCATATTCGTCACAAGCGGCATCAGATAACTCAATCACAGCTTCCTACCTCTTACACTCATGCGGATTCCCTCCCGACAAGGCGATTTCAGCTTCCAAATCCTTAAACATCGACACCCCAGATCGAGCAGACTCTGTGATATCATTTTTCAAGAATCAAGGATTCACACAAACCCAAATCTC...

CDS

Download CDS FASTA

507 bp · LXL04_018347|LXL04_018347|OH1004|CDS

ATGTTTAATCTCGTCGGCAGAAACTTGACAATTTCTGTATTCAAATCATCATCGGTTCATAGATTATTTCTTCGCACATCATATTCGTCACAAGCGGCATCAGATAACTCAATCACAGCTTCCTACCTCTTACACTCATGCGGATTCCCTCCCGACAAGGCGATTTCAGCTTCCAAATCCTTAAACATCGACACCCCAGATCGAGCAGACTCTGTGATATCATTTTTCAAGAATCAAGGATTCACACAAACCCAAATCTC...

Protein

Download Protein FASTA

168 aa · LXL04_018347|LXL04_018347|OH1004|PROTEIN

MFNLVGRNLTISVFKSSSVHRLFLRTSYSSQAASDNSITASYLLHSCGFPPDKAISASKSLNIDTPDRADSVISFFKNQGFTQTQISHLVRKFPMALDFNPQTHFLPKFEFLRSAGLSDSDIVKLLIARPKSLRTSLKNHIQPTFNLLTDLLQSSDKTLTAIGICNQL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018347`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018347

Location Chr04:11891741-11892247 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55580`	Transcription termination factor required for processing and steady-state levels of plastid transcripts.	Mutations in the plant-conserved MTERF9 alter chloroplast gene expression, development and tolerance to abiotic stress in Arabidopsis thaliana.2015 · DOI: 10.1111/ppl.12307

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018347 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006353 DNA-templated transcription termination Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0010343 singlet oxygen-mediated programmed cell death Biological Process

GO:0032502 developmental process Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:1904821 chloroplast disassembly Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003676 nucleic acid binding Molecular Function

KEGG gene cross-reference

ath:AT5G55580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.732

Rank 1 · LXL04_018347 · OH-1004

Plastid0.143

Rank 2 · LXL04_018347 · OH-1004

Nucleus0.039

Rank 3 · LXL04_018347 · OH-1004

Cytoplasm0.037

Rank 4 · LXL04_018347 · OH-1004

Cell membrane0.006

Rank 5 · LXL04_018347 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02536.20mTERF73-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018347	`PF02536.20`	mTERF	73	157	1.4e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM80`	Arabidopsis thaliana	Transcription termination factor MTERF9, chloroplastic	32.143%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card