LXL04_018205 | RubberDandelionOmics

Gene overview

LXL04_018205

Reference: OH-1004 Chr: Chr04 Coordinates: 8618110-8619054 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

585 bp · LXL04_018205|LXL04_018205|OH1004|cDNA

ATGCCAGGGTATCACGAAATCCAGATTATAGGGATAATCCAACAAGGAACAAATTTAGATTATGACACTAATCTAAATTTTAGAACTAGTAATTTATACACTACTAGAAATACAGTATCGATTGTAGCCGCCTCTCACTCTATCATCGTCGATTTCAGCCAACCCCTCCTCTATCATCGTCGATTACAGCCAACTCTTCCTCTATCATCGTCGATTCCGGCAACCTACACCCCCATCATCGTCGATTCCGGCACCCTACA...

CDS

Download CDS FASTA

585 bp · LXL04_018205|LXL04_018205|OH1004|CDS

ATGCCAGGGTATCACGAAATCCAGATTATAGGGATAATCCAACAAGGAACAAATTTAGATTATGACACTAATCTAAATTTTAGAACTAGTAATTTATACACTACTAGAAATACAGTATCGATTGTAGCCGCCTCTCACTCTATCATCGTCGATTTCAGCCAACCCCTCCTCTATCATCGTCGATTACAGCCAACTCTTCCTCTATCATCGTCGATTCCGGCAACCTACACCCCCATCATCGTCGATTCCGGCACCCTACA...

Protein

Download Protein FASTA

194 aa · LXL04_018205|LXL04_018205|OH1004|PROTEIN

MPGYHEIQIIGIIQQGTNLDYDTNLNFRTSNLYTTRNTVSIVAASHSIIVDFSQPLLYHRRLQPTLPLSSSIPATYTPIIVDSGTLHPIIVDYSNLHPHHLSFTPSRTQLLQAIETIRDLMAGAMMGGMVHTVVAPIERVKLLLQTQESNIAIVGGKHRRFNGMIDCIVHTVKNEGVLPFSLWIWKERRVYVTF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018205`
TK1151 ID	TkA03G493030
OH-1004 ID	LXL04_018205
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	59.100
Protein coverage (%)	TK1151 72.254 / OH-1004 72.165 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018205

Location Chr04:8618110-8619054 (-)

Description Similar to At5g56450: Probable ADP,ATP carrier protein At5g56450

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56450`	ADP:ATP antiporter that catalyzes the exchange of ADP and ATP across the membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018205 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0046902 regulation of mitochondrial membrane permeability Biological Process

GO:0048653 anther development Biological Process

GO:0140021 mitochondrial ADP transmembrane transport Biological Process

GO:1990544 mitochondrial ATP transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Cellular Component

GO:0005757 mitochondrial permeability transition pore complex Cellular Component

GO:0016020 membrane Cellular Component

GO:0005347 ATP transmembrane transporter activity Molecular Function

GO:0005471 ATP:ADP antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G56450

bta:282480

hsa:293

ssc:403155

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.376

Rank 1 · LXL04_018205 · OH-1004

Nucleus0.248

Rank 2 · LXL04_018205 · OH-1004

Mitochondrion0.137

Rank 3 · LXL04_018205 · OH-1004

Endoplasmic reticulum0.128

Rank 4 · LXL04_018205 · OH-1004

Plastid0.102

Rank 5 · LXL04_018205 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr115-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018205	`PF00153.33`	Mito_carr	115	178	8.3e-11	42.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM86`	Arabidopsis thaliana	ADP/ATP translocase At5g56450	68.571%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card