Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1185 bp · LXL04_018164|LXL04_018164|OH1004|cDNA
atgtcacCACCTCTTTTCCTCATTCAGATTAAACGTGATCCAATGACTGAAATTGAATCTCACAATTTCATATTTTTAATTAGTTTTAAAAgaacatcttttgagaactcatatattcccgagaacccgagaactcccaaaccgttaactttttcgaaaaaccgacttcggggggctaaaaatcgctcaaatataagcccggttgcaaaaaaaaaattccgaaagaacgacttttttttttccaaaaactttgcatatgt...
1185 bp · LXL04_018164|LXL04_018164|OH1004|CDS
ATGTCACCACCTCTTTTCCTCATTCAGATTAAACGTGATCCAATGACTGAAATTGAATCTCACAATTTCATATTTTTAATTAGTTTTAAAAGAACATCTTTTGAGAACTCATATATTCCCGAGAACCCGAGAACTCCCAAACCGTTAACTTTTTCGAAAAACCGACTTCGGGGGGCTAAAAATCGCTCAAATATAAGCCCGGTTGCAAAAAAAAAATTCCGAAAGAACGACTTTTTTTTTTCCAAAAACTTTGCATATGT...
Protein
Download Protein FASTA394 aa · LXL04_018164|LXL04_018164|OH1004|PROTEIN
MSPPLFLIQIKRDPMTEIESHNFIFLISFKRTSFENSYIPENPRTPKPLTFSKNRLRGAKNRSNISPVAKKKFRKNDFFFSKNFAYVQTFFVCICAQFFVLFQNRSKTRNFFKFFYRSLYNTYLKRFVKKNLKKNAKKKSCTYAQKIKKSCTYAKVKKKYRFFGNFFQRIVMIKNVLEGSEVGQYTSTSGDHYRDPQDNRCWDLLRTHIFPRTRELPQFPISPKPLFLSKNRLRNPPKRSYKKNLKKFRFSEKKKSFFRK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_018164 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_018164 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:7894210-7899454 (+) | ||||||||||||
| Description | Similar to NOA1: NO-associated protein 1, chloroplastic/mitochondrial | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006809 nitric oxide biosynthetic process Biological Process GO:0006979 response to oxidative stress Biological Process GO:0009651 response to salt stress Biological Process GO:0009657 plastid organization Biological Process GO:0010027 thylakoid membrane organization Biological Process GO:0010193 response to ozone Biological Process GO:0010322 regulation of isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process GO:0048366 leaf development Biological Process GO:0051246 regulation of protein metabolic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component GO:0003924 GTPase activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT3G47450 dosa:Os02g0104700 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.