LXL04_018162 | RubberDandelionOmics

Gene overview

LXL04_018162

Reference: OH-1004 Chr: Chr04 Coordinates: 7874695-7875479 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

390 bp · LXL04_018162|LXL04_018162|OH1004|cDNA

ATGGTGAAAGGCCGTCAAGGGGAACGTGTCAGACTCTACACAAGAGGAACAGTTCTCGGATACAAAAGGTCGAAGTCGAACCAGTACCCAAACACATCGTTGGTACAAATTGAAGGAGTTAATACTAAGGAGGAGGTTTCATGGTACCAAGGGAAGCGCTTGGCGTACATCTACAAGGCCAAGGTGAAGAGGGACGGTTCACATCCAATCTTCCTCCTAAATCCATGGGAGCTAGGGTTAGGGTGTTCATGTACCCAAGC...

CDS

Download CDS FASTA

390 bp · LXL04_018162|LXL04_018162|OH1004|CDS

ATGGTGAAAGGCCGTCAAGGGGAACGTGTCAGACTCTACACAAGAGGAACAGTTCTCGGATACAAAAGGTCGAAGTCGAACCAGTACCCAAACACATCGTTGGTACAAATTGAAGGAGTTAATACTAAGGAGGAGGTTTCATGGTACCAAGGGAAGCGCTTGGCGTACATCTACAAGGCCAAGGTGAAGAGGGACGGTTCACATCCAATCTTCCTCCTAAATCCATGGGAGCTAGGGTTAGGGTGTTCATGTACCCAAGC...

Protein

Download Protein FASTA

129 aa · LXL04_018162|LXL04_018162|OH1004|PROTEIN

MVKGRQGERVRLYTRGTVLGYKRSKSNQYPNTSLVQIEGVNTKEEVSWYQGKRLAYIYKAKVKRDGSHPIFLLNPWELGLGCSCTQATFKFIEEEKKEDIISGVLRCYYFDSFVISLICSSYLNFCGNW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018162`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018162

Location Chr04:7874695-7875479 (+)

Description Similar to RPL35AA: 60S ribosomal protein L35a-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07070`	Large ribosomal subunit protein eL33w.	No verified direct reference in this release
`At1g74270`	Large ribosomal subunit protein eL33y.	No verified direct reference in this release
`At3g55750`	Large ribosomal subunit protein eL33x.	No verified direct reference in this release
`At1g41880`	Large ribosomal subunit protein eL33z.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018162 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0042273 ribosomal large subunit biogenesis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT1G07070

ath:AT1G41880

ath:AT1G74270

ath:AT3G55750

sce:YOR234C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.399

Rank 1 · LXL04_018162 · OH-1004

Cytoplasm0.393

Rank 2 · LXL04_018162 · OH-1004

Mitochondrion0.147

Rank 3 · LXL04_018162 · OH-1004

Cell membrane0.090

Rank 4 · LXL04_018162 · OH-1004

Endoplasmic reticulum0.076

Rank 5 · LXL04_018162 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01247.25Ribosomal_L35Ae12-66 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018162	`PF01247.25`	Ribosomal_L35Ae	12	66	1.6e-19	70.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMK0`	Arabidopsis thaliana	Large ribosomal subunit protein eL33w	86.765%	Swiss-Prot	moderate database homology
`Q9C912`	Arabidopsis thaliana	Large ribosomal subunit protein eL33y	86.765%	Swiss-Prot	moderate database homology
`P51422`	Arabidopsis thaliana	Large ribosomal subunit protein eL33x	88.060%	Swiss-Prot	moderate database homology
`Q9FZH0`	Arabidopsis thaliana	Large ribosomal subunit protein eL33z	86.567%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card