LXL04_018158 | RubberDandelionOmics

Gene overview

LXL04_018158

Reference: OH-1004 Chr: Chr04 Coordinates: 7853749-7857483 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2325 bp · LXL04_018158|LXL04_018158|OH1004|cDNA

AAGACTATCGCCGCACAGAGAGCATTTCTAGATAGCTAGAGAGAAAGTCGACTAGAGACCGAAAGAGAATATCGACGATTAAAGATGTCTGGCTGGGATGAAGGTGCGATATTCTACAGCGACCAAGCACAGTTCCCTCACGGCGCCGGCGCCGACCCTGAACAGGCGTCGAACCGGCACACGGTGCTCAGAAAGTTCAAAGAGTTCATCCGAAACTTCGCTCGTCAAAATGAGCCCAACGTCTTCCCTTACAGAGAAAG...

CDS

Download CDS FASTA

2241 bp · LXL04_018158|LXL04_018158|OH1004|CDS

ATGTCTGGCTGGGATGAAGGTGCGATATTCTACAGCGACCAAGCACAGTTCCCTCACGGCGCCGGCGCCGACCCTGAACAGGCGTCGAACCGGCACACGGTGCTCAGAAAGTTCAAAGAGTTCATCCGAAACTTCGCTCGTCAAAATGAGCCCAACGTCTTCCCTTACAGAGAAAGCCTGGTTCAAAATCCCAAGTTTCTCCTCGTTAATATGTCCGATCTTCTTACCTACGACAAAGATCAAGATCTTCGAGATTTGCT...

Protein

Download Protein FASTA

746 aa · LXL04_018158|LXL04_018158|OH1004|PROTEIN

MSGWDEGAIFYSDQAQFPHGAGADPEQASNRHTVLRKFKEFIRNFARQNEPNVFPYRESLVQNPKFLLVNMSDLLTYDKDQDLRDLLRKNPSDYLPLFETAAAEVNANLKARVAGETGEMEEPHTGEVQILLNSDEDPVSMRSLGAQYISKLVKISGITIAASRTKAKATYVTLLCKNCKNVKVVPCRPGLGGAIVPRSCDHVAQMGETPCPIDPWLVVPDRSKYVDQQTLKLQENPEDVPTGELPRNMLLSVDRHLVQT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018158`
TK1151 ID	TkA08G023140
OH-1004 ID	LXL04_018158
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018158

Location Chr04:7853749-7857483 (-)

Description Similar to MCM5: DNA replication licensing factor MCM5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g07690`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0797400`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release
`UniProt: B8AEH3`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018158 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000727 double-strand break repair via break-induced replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006279 premeiotic DNA replication Biological Process

GO:0030174 regulation of DNA-templated DNA replication initiation Biological Process

GO:0044786 cell cycle DNA replication Biological Process

GO:0000347 THO complex Cellular Component

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0042555 MCM complex Cellular Component

GO:0071162 CMG complex Cellular Component

GO:0003678 DNA helicase activity Molecular Function

KEGG gene cross-reference

ath:AT2G07690

dosa:Os02g0797400

xla:380587

xtr:550081

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.814

Rank 1 · LXL04_018158 · OH-1004

Cytoplasm0.248

Rank 2 · LXL04_018158 · OH-1004

Mitochondrion0.035

Rank 3 · LXL04_018158 · OH-1004

Cell membrane0.025

Rank 4 · LXL04_018158 · OH-1004

Endoplasmic reticulum0.013

Rank 5 · LXL04_018158 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14551.12MCM_N36-132 aa

PF17207.10MCM_OB141-276 aa

PF00493.30MCM319-541 aa

PF17855.8MCM_lid578-661 aa

PF21933.3MCM5_C686-744 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018158	`PF14551.12`	MCM_N	36	132	9.1e-12	46.0
LXL04_018158	`PF17207.10`	MCM_OB	141	276	3.3e-33	114.9
LXL04_018158	`PF00493.30`	MCM	319	541	1.2e-102	342.5
LXL04_018158	`PF17855.8`	MCM_lid	578	661	1.4e-23	83.8
LXL04_018158	`PF21933.3`	MCM5_C	686	744	8.2e-19	68.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80786`	Arabidopsis thaliana	DNA replication licensing factor MCM5	75.802%	Swiss-Prot	strong database homology
`Q6KAJ4`	Oryza sativa subsp. japonica	DNA replication licensing factor MCM5	72.800%	Swiss-Prot	strong database homology
`B8AEH3`	Oryza sativa subsp. indica	DNA replication licensing factor MCM5	72.667%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card