LXL04_018133 | RubberDandelionOmics

Gene overview

LXL04_018133

Reference: OH-1004 Chr: Chr04 Coordinates: 7130880-7140475 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3558 bp · LXL04_018133|LXL04_018133|OH1004|cDNA

ATGGCGATGTTGCTGAAATTGTTTTATAAGAAGCCGCCTGAAGGACTTTTCGATGTTTGTGAAAGAATATACGTCTTTGACTCCTGTTTCAGAATTAAAACTTGGGAACAAGAAGAATACAACACCTACGTGGGCAAGATCATAAGTAAATTTAAGAAAACTTATCCTAAATCTTCAGAAATGGTATTCAATTTTCGGGAGGGAGATACGGCAAGCAAGATCCACCAACTTTTATTACCATACCATATTACTATAATAGA...

CDS

Download CDS FASTA

3558 bp · LXL04_018133|LXL04_018133|OH1004|CDS

ATGGCGATGTTGCTGAAATTGTTTTATAAGAAGCCGCCTGAAGGACTTTTCGATGTTTGTGAAAGAATATACGTCTTTGACTCCTGTTTCAGAATTAAAACTTGGGAACAAGAAGAATACAACACCTACGTGGGCAAGATCATAAGTAAATTTAAGAAAACTTATCCTAAATCTTCAGAAATGGTATTCAATTTTCGGGAGGGAGATACGGCAAGCAAGATCCACCAACTTTTATTACCATACCATATTACTATAATAGA...

Protein

Download Protein FASTA

1185 aa · LXL04_018133|LXL04_018133|OH1004|PROTEIN

MAMLLKLFYKKPPEGLFDVCERIYVFDSCFRIKTWEQEEYNTYVGKIISKFKKTYPKSSEMVFNFREGDTASKIHQLLLPYHITIIDYPQNYEGCPLLSMEVINHFLKSSENWLSLGQHNVLLMHSELGGWPVLAFMSAALLLYRKHHTSANKALEKVYKQAPPDVLSRLMSPLNSLASQLRYLQYVLKRNDVEQWPPADKPLTLVCVMMRMVPDFDGKGGCCPVFRIYGRDPSLDLDKTPKLLFSTPRCSKNTPYYNQA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018133`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018133

Location Chr04:7130880-7140475 (+)

Description Similar to FH17: Formin-like protein 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25050`	Formin-like protein 18.	No verified direct reference in this release
`At5g58160`	Formin-like protein 13.	No verified direct reference in this release
`At3g32400`	Formin-like protein 17.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0280200`	Formin-like protein 6.	No verified direct reference in this release
`Os02g0794900`	Formin-like protein 7.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018133 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003779 actin binding Molecular Function

GO:0004721 phosphoprotein phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT2G25050

ath:AT3G32400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.738

Rank 1 · LXL04_018133 · OH-1004

Nucleus0.190

Rank 2 · LXL04_018133 · OH-1004

Cell membrane0.182

Rank 3 · LXL04_018133 · OH-1004

Golgi apparatus0.056

Rank 4 · LXL04_018133 · OH-1004

Mitochondrion0.047

Rank 5 · LXL04_018133 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10409.16PTEN_C2199-338 aa

PF02181.29FH2356-729 aa

PF02181.29FH2760-935 aa

PF02181.29FH2972-1151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018133	`PF10409.16`	PTEN_C2	199	338	1e-33	116.6
LXL04_018133	`PF02181.29`	FH2	356	729	5.7e-178	592.4
LXL04_018133	`PF02181.29`	FH2	760	935	5.7e-178	592.4
LXL04_018133	`PF02181.29`	FH2	972	1151	5.7e-178	592.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SK28`	Arabidopsis thaliana	Formin-like protein 18	57.143%	Swiss-Prot	weak database homology
`Q9LVN1`	Arabidopsis thaliana	Formin-like protein 13	53.880%	Swiss-Prot	weak database homology
`Q9LH02`	Arabidopsis thaliana	Formin-like protein 17	55.172%	Swiss-Prot	weak database homology
`Q6ZCX3`	Oryza sativa subsp. japonica	Formin-like protein 6	53.037%	Swiss-Prot	weak database homology
`Q6K8Z4`	Oryza sativa subsp. japonica	Formin-like protein 7	52.558%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card